BLASTX nr result
ID: Ziziphus21_contig00042847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042847 (473 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014230859.1| PREDICTED: small nuclear ribonucleoprotein G... 118 2e-24 ref|XP_002429935.1| membrane-associated protein, putative [Pedic... 118 2e-24 ref|XP_312222.2| AGAP002706-PA [Anopheles gambiae str. PEST] gi|... 117 4e-24 ref|XP_005285279.1| PREDICTED: small nuclear ribonucleoprotein G... 116 6e-24 ref|XP_001659450.1| AAEL008719-PA [Aedes aegypti] gi|108875262|g... 116 6e-24 gb|KPM08875.1| LSM domain containing protein [Sarcoptes scabiei] 116 7e-24 gb|ETN65074.1| small ribonucleoprotein G [Anopheles darlingi] 116 7e-24 gb|AEE63540.1| unknown [Dendroctonus ponderosae] gi|478252926|gb... 116 7e-24 ref|XP_011498223.1| PREDICTED: probable small nuclear ribonucleo... 115 1e-23 tpg|DAA28894.1| TPA: small nuclear ribonucleoprotein polypeptide... 115 1e-23 ref|XP_007909164.1| PREDICTED: small nuclear ribonucleoprotein G... 115 1e-23 gb|ELU09428.1| hypothetical protein CAPTEDRAFT_156804 [Capitella... 115 2e-23 ref|XP_014216275.1| PREDICTED: probable small nuclear ribonucleo... 114 2e-23 ref|XP_002709854.1| PREDICTED: small nuclear ribonucleoprotein G... 114 2e-23 ref|XP_002071290.1| GK25208 [Drosophila willistoni] gi|194167375... 114 2e-23 ref|XP_006032961.1| PREDICTED: small nuclear ribonucleoprotein G... 114 2e-23 ref|NP_001187842.1| small nuclear ribonucleoprotein g [Ictalurus... 114 2e-23 ref|NP_001165120.1| small nuclear ribonucleoprotein G [Xenopus (... 114 2e-23 ref|XP_014281054.1| PREDICTED: small nuclear ribonucleoprotein G... 114 3e-23 ref|NP_003087.1| small nuclear ribonucleoprotein G isoform a [Ho... 114 3e-23 >ref|XP_014230859.1| PREDICTED: small nuclear ribonucleoprotein G [Trichogramma pretiosum] Length = 76 Score = 118 bits (295), Expect = 2e-24 Identities = 54/76 (71%), Positives = 67/76 (88%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDKKL+ KLNG R V GILRGFDPFMN+V+DE+VE +D TQ +G+V Sbjct: 1 MSKAHPPELKKYMDKKLSLKLNGGRHVTGILRGFDPFMNMVIDESVEFCKDGTQNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNS++++EAL+R+ Sbjct: 61 VIRGNSVIMLEALDRI 76 >ref|XP_002429935.1| membrane-associated protein, putative [Pediculus humanus corporis] gi|212514981|gb|EEB17197.1| membrane-associated protein, putative [Pediculus humanus corporis] Length = 76 Score = 118 bits (295), Expect = 2e-24 Identities = 56/76 (73%), Positives = 67/76 (88%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL KLNG R VNGILRGFDPFMNLV+DE+VEI ++ T +G+V Sbjct: 1 MSKAHPPELKKFMDKKLALKLNGGRQVNGILRGFDPFMNLVIDESVEICKNGTHNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNS+V++EAL+RV Sbjct: 61 VIRGNSVVMLEALDRV 76 >ref|XP_312222.2| AGAP002706-PA [Anopheles gambiae str. PEST] gi|170033098|ref|XP_001844416.1| conserved hypothetical protein [Culex quinquefasciatus] gi|55242066|gb|EAA07689.2| AGAP002706-PA [Anopheles gambiae str. PEST] gi|167873530|gb|EDS36913.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 76 Score = 117 bits (292), Expect = 4e-24 Identities = 54/76 (71%), Positives = 69/76 (90%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDK+L+ KLNG RVV+GILRGFDPFMN+VVDE++E +D T+ +G+V Sbjct: 1 MSKAHPPELKKYMDKRLSLKLNGGRVVSGILRGFDPFMNVVVDESIEECKDGTRNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EAL+R+ Sbjct: 61 VIRGNSIIMVEALDRI 76 >ref|XP_005285279.1| PREDICTED: small nuclear ribonucleoprotein G [Chrysemys picta bellii] gi|591382000|ref|XP_007065531.1| PREDICTED: small nuclear ribonucleoprotein G [Chelonia mydas] Length = 76 Score = 116 bits (291), Expect = 6e-24 Identities = 56/76 (73%), Positives = 66/76 (86%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLV+DE VE+ + Q T+G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMAQGGQQNTIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|XP_001659450.1| AAEL008719-PA [Aedes aegypti] gi|108875262|gb|EAT39487.1| AAEL008719-PA [Aedes aegypti] Length = 76 Score = 116 bits (291), Expect = 6e-24 Identities = 53/76 (69%), Positives = 69/76 (90%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDK+L+ KLNG RVV+GILRGFDPFMN+V+DE++E +D T+ +G+V Sbjct: 1 MSKAHPPELKKYMDKRLSLKLNGGRVVSGILRGFDPFMNVVLDESIEECKDSTRNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EAL+R+ Sbjct: 61 VIRGNSIIMVEALDRI 76 >gb|KPM08875.1| LSM domain containing protein [Sarcoptes scabiei] Length = 76 Score = 116 bits (290), Expect = 7e-24 Identities = 52/76 (68%), Positives = 67/76 (88%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MS+AHPPELKKYMDK+L+ KLNG R ++GILRGFDPFMNLV+DEAVEI + Q +G+V Sbjct: 1 MSRAHPPELKKYMDKRLSLKLNGNRQISGILRGFDPFMNLVIDEAVEINKRNQQVPIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 V+RGNS+V++EAL+R+ Sbjct: 61 VVRGNSVVLLEALDRI 76 >gb|ETN65074.1| small ribonucleoprotein G [Anopheles darlingi] Length = 76 Score = 116 bits (290), Expect = 7e-24 Identities = 53/76 (69%), Positives = 69/76 (90%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDK+L+ KLNG RVV+GILRGFDPFMN+V+DE++E +D T+ +G+V Sbjct: 1 MSKAHPPELKKYMDKRLSLKLNGGRVVSGILRGFDPFMNVVLDESIEECKDGTRNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EAL+R+ Sbjct: 61 VIRGNSIILVEALDRI 76 >gb|AEE63540.1| unknown [Dendroctonus ponderosae] gi|478252926|gb|ENN73310.1| hypothetical protein YQE_10074, partial [Dendroctonus ponderosae] gi|546681603|gb|ERL91667.1| hypothetical protein D910_08995 [Dendroctonus ponderosae] Length = 76 Score = 116 bits (290), Expect = 7e-24 Identities = 56/76 (73%), Positives = 66/76 (86%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL KLNG R V GILRGFDPFMNLVVDE++E RD T+ +G+V Sbjct: 1 MSKAHPPELKKFMDKKLCLKLNGGRQVTGILRGFDPFMNLVVDESIEECRDGTKNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSIV++EAL+R+ Sbjct: 61 VIRGNSIVMLEALDRI 76 >ref|XP_011498223.1| PREDICTED: probable small nuclear ribonucleoprotein G [Ceratosolen solmsi marchali] Length = 76 Score = 115 bits (289), Expect = 1e-23 Identities = 52/76 (68%), Positives = 68/76 (89%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDKKL+ KLNG R+V GILRGFDPFMN+V+DE++E +D T+ +G+V Sbjct: 1 MSKAHPPELKKYMDKKLSLKLNGGRLVMGILRGFDPFMNMVIDESIEECKDGTKNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNS++++EAL+R+ Sbjct: 61 VIRGNSVIMLEALDRI 76 >tpg|DAA28894.1| TPA: small nuclear ribonucleoprotein polypeptide G-like [Bos taurus] Length = 76 Score = 115 bits (289), Expect = 1e-23 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R+V GILRGFDPFMNLV+DE VE+ Q +G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRLVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|XP_007909164.1| PREDICTED: small nuclear ribonucleoprotein G [Callorhinchus milii] Length = 76 Score = 115 bits (288), Expect = 1e-23 Identities = 56/76 (73%), Positives = 66/76 (86%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLVVDE+VE+ + Q +G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVVDESVEMTQGGQQNVIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >gb|ELU09428.1| hypothetical protein CAPTEDRAFT_156804 [Capitella teleta] Length = 76 Score = 115 bits (287), Expect = 2e-23 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDK+LT KLNG RVV G LRGFDPFMNLVVDEA+E + Q ++G+V Sbjct: 1 MSKAHPPELKKYMDKRLTLKLNGGRVVTGTLRGFDPFMNLVVDEAIEQCKTGEQNSIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 V+RGNSI ++EAL+RV Sbjct: 61 VVRGNSITLLEALDRV 76 >ref|XP_014216275.1| PREDICTED: probable small nuclear ribonucleoprotein G isoform X1 [Copidosoma floridanum] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 54/76 (71%), Positives = 68/76 (89%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDKKL+ KLNG R V GILRGFDPFMN+VVDE++E +D T+ ++G+V Sbjct: 1 MSKAHPPELKKYMDKKLSLKLNGGRHVIGILRGFDPFMNMVVDESIEECKDGTKNSIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EAL+R+ Sbjct: 61 VIRGNSIIMIEALDRI 76 >ref|XP_002709854.1| PREDICTED: small nuclear ribonucleoprotein G [Oryctolagus cuniculus] gi|504135275|ref|XP_004580118.1| PREDICTED: small nuclear ribonucleoprotein G [Ochotona princeps] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 55/76 (72%), Positives = 64/76 (84%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLV+DE VE+ Q +G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMANSGQQNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|XP_002071290.1| GK25208 [Drosophila willistoni] gi|194167375|gb|EDW82276.1| uncharacterized protein Dwil_GK25208 [Drosophila willistoni] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 53/76 (69%), Positives = 66/76 (86%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKKYMDK++ KLNG R VNGILRGFDPFMN+V+D+ +E +D T+ +G+V Sbjct: 1 MSKAHPPELKKYMDKRMMLKLNGGRAVNGILRGFDPFMNVVLDDTIEECKDNTKNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSIV++EAL+RV Sbjct: 61 VIRGNSIVMVEALDRV 76 >ref|XP_006032961.1| PREDICTED: small nuclear ribonucleoprotein G [Alligator sinensis] gi|558189699|ref|XP_006129156.1| PREDICTED: small nuclear ribonucleoprotein G [Pelodiscus sinensis] gi|951055111|ref|XP_014465292.1| PREDICTED: small nuclear ribonucleoprotein G [Alligator mississippiensis] gi|951055116|ref|XP_014465293.1| PREDICTED: small nuclear ribonucleoprotein G [Alligator mississippiensis] gi|951055120|ref|XP_014465294.1| PREDICTED: small nuclear ribonucleoprotein G [Alligator mississippiensis] gi|951055124|ref|XP_014465295.1| PREDICTED: small nuclear ribonucleoprotein G [Alligator mississippiensis] gi|944419047|gb|KQL64073.1| family with sequence similarity 136, member A [Alligator mississippiensis] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 55/76 (72%), Positives = 65/76 (85%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLV+DE VE+ + Q +G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMAQGGQQNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|NP_001187842.1| small nuclear ribonucleoprotein g [Ictalurus punctatus] gi|308324118|gb|ADO29194.1| small nuclear ribonucleoprotein g [Ictalurus punctatus] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 55/76 (72%), Positives = 66/76 (86%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLVVD+++EI Q ++G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVVDDSIEISAGGQQNSIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|NP_001165120.1| small nuclear ribonucleoprotein G [Xenopus (Silurana) tropicalis] gi|138519693|gb|AAI35835.1| LOC100125174 protein [Xenopus (Silurana) tropicalis] Length = 76 Score = 114 bits (286), Expect = 2e-23 Identities = 56/76 (73%), Positives = 64/76 (84%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLV+DE EI Q T+G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECTEISGGGHQNTIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76 >ref|XP_014281054.1| PREDICTED: small nuclear ribonucleoprotein G [Halyomorpha halys] Length = 76 Score = 114 bits (285), Expect = 3e-23 Identities = 55/76 (72%), Positives = 67/76 (88%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL KLNG R V GILRGFDPFMN+VVDE +E ++D ++K +G+V Sbjct: 1 MSKAHPPELKKFMDKKLCIKLNGGRNVVGILRGFDPFMNMVVDECLEEKKDGSRKPIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMVEALERV 76 >ref|NP_003087.1| small nuclear ribonucleoprotein G isoform a [Homo sapiens] gi|13385994|ref|NP_080782.1| small nuclear ribonucleoprotein G [Mus musculus] gi|94966887|ref|NP_001035633.1| small nuclear ribonucleoprotein G [Bos taurus] gi|205360903|ref|NP_001128557.1| small nuclear ribonucleoprotein G [Rattus norvegicus] gi|301172846|ref|NP_001180369.1| small nuclear ribonucleoprotein G [Macaca mulatta] gi|356640205|ref|NP_001239260.1| small nuclear ribonucleoprotein G [Canis lupus familiaris] gi|109461740|ref|XP_001079708.1| PREDICTED: small nuclear ribonucleoprotein G [Rattus norvegicus] gi|296223614|ref|XP_002757696.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Callithrix jacchus] gi|297667399|ref|XP_002811973.1| PREDICTED: small nuclear ribonucleoprotein G [Pongo abelii] gi|301758206|ref|XP_002914946.1| PREDICTED: small nuclear ribonucleoprotein G [Ailuropoda melanoleuca] gi|311252444|ref|XP_003125100.1| PREDICTED: small nuclear ribonucleoprotein G [Sus scrofa] gi|332226773|ref|XP_003262565.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Nomascus leucogenys] gi|338714212|ref|XP_003363026.1| PREDICTED: small nuclear ribonucleoprotein G [Equus caballus] gi|344283913|ref|XP_003413715.1| PREDICTED: small nuclear ribonucleoprotein G [Loxodonta africana] gi|348566567|ref|XP_003469073.1| PREDICTED: small nuclear ribonucleoprotein G [Cavia porcellus] gi|354491761|ref|XP_003508023.1| PREDICTED: small nuclear ribonucleoprotein G-like [Cricetulus griseus] gi|392344154|ref|XP_003748887.1| PREDICTED: small nuclear ribonucleoprotein G [Rattus norvegicus] gi|402891180|ref|XP_003908832.1| PREDICTED: small nuclear ribonucleoprotein G [Papio anubis] gi|403260478|ref|XP_003922698.1| PREDICTED: small nuclear ribonucleoprotein G [Saimiri boliviensis boliviensis] gi|410955001|ref|XP_003984147.1| PREDICTED: small nuclear ribonucleoprotein G [Felis catus] gi|426223378|ref|XP_004005852.1| PREDICTED: small nuclear ribonucleoprotein G [Ovis aries] gi|466044757|ref|XP_004277087.1| PREDICTED: small nuclear ribonucleoprotein G [Orcinus orca] gi|470631738|ref|XP_004322045.1| PREDICTED: small nuclear ribonucleoprotein G-like [Tursiops truncatus] gi|471357397|ref|XP_004369290.1| PREDICTED: small nuclear ribonucleoprotein G [Trichechus manatus latirostris] gi|472358162|ref|XP_004398706.1| PREDICTED: small nuclear ribonucleoprotein G [Odobenus rosmarus divergens] gi|472396813|ref|XP_004417626.1| PREDICTED: small nuclear ribonucleoprotein G [Odobenus rosmarus divergens] gi|478522852|ref|XP_004435630.1| PREDICTED: small nuclear ribonucleoprotein G [Ceratotherium simum simum] gi|488537037|ref|XP_004460184.1| PREDICTED: small nuclear ribonucleoprotein G [Dasypus novemcinctus] gi|505804291|ref|XP_004609197.1| PREDICTED: small nuclear ribonucleoprotein G [Sorex araneus] gi|507656397|ref|XP_004634111.1| PREDICTED: small nuclear ribonucleoprotein G [Octodon degus] gi|507973879|ref|XP_004691551.1| PREDICTED: small nuclear ribonucleoprotein G [Condylura cristata] gi|511835185|ref|XP_004742200.1| PREDICTED: small nuclear ribonucleoprotein G [Mustela putorius furo] gi|512975785|ref|XP_004849966.1| PREDICTED: small nuclear ribonucleoprotein G [Heterocephalus glaber] gi|524936234|ref|XP_005071161.1| PREDICTED: small nuclear ribonucleoprotein G [Mesocricetus auratus] gi|532044068|ref|XP_005364851.1| PREDICTED: small nuclear ribonucleoprotein G [Microtus ochrogaster] gi|533142062|ref|XP_005385673.1| PREDICTED: small nuclear ribonucleoprotein G [Chinchilla lanigera] gi|544480782|ref|XP_005575713.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Macaca fascicularis] gi|548486380|ref|XP_005686902.1| PREDICTED: small nuclear ribonucleoprotein G [Capra hircus] gi|555963157|ref|XP_005893665.1| PREDICTED: small nuclear ribonucleoprotein G [Bos mutus] gi|560933444|ref|XP_006192827.1| PREDICTED: small nuclear ribonucleoprotein G [Camelus ferus] gi|560958313|ref|XP_006201619.1| PREDICTED: small nuclear ribonucleoprotein G [Vicugna pacos] gi|586464706|ref|XP_006862980.1| PREDICTED: small nuclear ribonucleoprotein G [Chrysochloris asiatica] gi|586548997|ref|XP_006909573.1| PREDICTED: small nuclear ribonucleoprotein G [Pteropus alecto] gi|591314087|ref|XP_007083476.1| PREDICTED: small nuclear ribonucleoprotein G [Panthera tigris altaica] gi|593747393|ref|XP_007128988.1| PREDICTED: small nuclear ribonucleoprotein G [Physeter catodon] gi|594113879|ref|XP_006079679.1| PREDICTED: small nuclear ribonucleoprotein G-like [Bubalus bubalis] gi|594654405|ref|XP_007175607.1| PREDICTED: small nuclear ribonucleoprotein G [Balaenoptera acutorostrata scammoni] gi|602682390|ref|XP_007453466.1| PREDICTED: small nuclear ribonucleoprotein G [Lipotes vexillifer] gi|625232673|ref|XP_007607481.1| PREDICTED: small nuclear ribonucleoprotein G [Cricetulus griseus] gi|634846151|ref|XP_007938298.1| PREDICTED: small nuclear ribonucleoprotein G [Orycteropus afer afer] gi|635080121|ref|XP_007968517.1| PREDICTED: small nuclear ribonucleoprotein G isoform X6 [Chlorocebus sabaeus] gi|635080123|ref|XP_007968518.1| PREDICTED: small nuclear ribonucleoprotein G isoform X7 [Chlorocebus sabaeus] gi|640808083|ref|XP_008060559.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Tarsius syrichta] gi|664712177|ref|XP_008513059.1| PREDICTED: small nuclear ribonucleoprotein G [Equus przewalskii] gi|667281378|ref|XP_008574406.1| PREDICTED: small nuclear ribonucleoprotein G [Galeopterus variegatus] gi|671014753|ref|XP_008698189.1| PREDICTED: small nuclear ribonucleoprotein G [Ursus maritimus] gi|674096231|ref|XP_008821469.1| PREDICTED: small nuclear ribonucleoprotein G [Nannospalax galili] gi|675796230|ref|XP_008954604.1| PREDICTED: small nuclear ribonucleoprotein G [Pan paniscus] gi|694894659|ref|XP_009440905.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Pan troglodytes] gi|724817124|ref|XP_010360201.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Rhinopithecus roxellana] gi|731278091|ref|XP_010607955.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Fukomys damarensis] gi|742147297|ref|XP_010843589.1| PREDICTED: small nuclear ribonucleoprotein G [Bison bison bison] gi|743735473|ref|XP_010962028.1| PREDICTED: small nuclear ribonucleoprotein G [Camelus bactrianus] gi|744563896|ref|XP_010978171.1| PREDICTED: small nuclear ribonucleoprotein G [Camelus dromedarius] gi|759135733|ref|XP_011363867.1| PREDICTED: small nuclear ribonucleoprotein G [Pteropus vampyrus] gi|795160282|ref|XP_011840427.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Mandrillus leucophaeus] gi|795180268|ref|XP_011800621.1| PREDICTED: small nuclear ribonucleoprotein G isoform X1 [Colobus angolensis palliatus] gi|795492194|ref|XP_011895114.1| PREDICTED: small nuclear ribonucleoprotein G [Cercocebus atys] gi|803280684|ref|XP_012000032.1| PREDICTED: small nuclear ribonucleoprotein G [Ovis aries musimon] gi|817324982|ref|XP_012289379.1| PREDICTED: small nuclear ribonucleoprotein G [Aotus nancymaae] gi|826299855|ref|XP_012501921.1| PREDICTED: small nuclear ribonucleoprotein G [Propithecus coquereli] gi|829974606|ref|XP_012605653.1| PREDICTED: small nuclear ribonucleoprotein G isoform X1 [Microcebus murinus] gi|829974609|ref|XP_012605654.1| PREDICTED: small nuclear ribonucleoprotein G isoform X2 [Microcebus murinus] gi|847037957|ref|XP_012806573.1| PREDICTED: small nuclear ribonucleoprotein G [Jaculus jaculus] gi|914903672|ref|XP_013212623.1| PREDICTED: small nuclear ribonucleoprotein G [Ictidomys tridecemlineatus] gi|947249474|ref|XP_014444837.1| PREDICTED: small nuclear ribonucleoprotein G [Tupaia chinensis] gi|59800216|sp|P62308.1|RUXG_HUMAN RecName: Full=Small nuclear ribonucleoprotein G; Short=snRNP-G; AltName: Full=Sm protein G; Short=Sm-G; Short=SmG gi|59800217|sp|P62309.1|RUXG_MOUSE RecName: Full=Small nuclear ribonucleoprotein G; Short=snRNP-G; AltName: Full=Sm protein G; Short=Sm-G; Short=SmG gi|109894862|sp|Q3ZBL0.1|RUXG_BOVIN RecName: Full=Small nuclear ribonucleoprotein G; Short=snRNP-G; AltName: Full=Sm protein G; Short=Sm-G; Short=SmG gi|225734046|pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp gi|225734055|pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp gi|225734064|pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp gi|225734073|pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp gi|315583606|pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp gi|315583615|pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp gi|332639439|pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639446|pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639453|pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639463|pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639470|pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639477|pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639487|pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639494|pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639501|pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639511|pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639518|pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|332639525|pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain gi|343781214|pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn, Gemin2 In Complex With Smd1D2FEG FROM HUMAN gi|444302204|pdb|4F7U|G Chain G, The 6s Snrnp Assembly Intermediate gi|444302205|pdb|4F7U|J Chain J, The 6s Snrnp Assembly Intermediate gi|453055429|pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate gi|453055437|pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate gi|453055445|pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate gi|453055453|pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate gi|453055461|pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate gi|453055469|pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate gi|453055473|pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate gi|453055485|pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate gi|453055493|pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate gi|453055501|pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate gi|453055509|pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate gi|453055517|pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate gi|453055525|pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate gi|453056017|pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate gi|453056025|pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate gi|453056033|pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate gi|453056041|pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate gi|453056049|pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate gi|453056057|pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate gi|453056061|pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate gi|742261267|pdb|4PJO|G Chain G, Minimal U1 Snrnp gi|742261278|pdb|4PJO|GG Chain g, Minimal U1 Snrnp gi|742261289|pdb|4PJO|U Chain U, Minimal U1 Snrnp gi|742261300|pdb|4PJO|UU Chain u, Minimal U1 Snrnp gi|806566|emb|CAA59689.1| Sm protein G [Homo sapiens] gi|12652645|gb|AAH00070.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|12849786|dbj|BAB28480.1| unnamed protein product [Mus musculus] gi|12850471|dbj|BAB28732.1| unnamed protein product [Mus musculus] gi|18490257|gb|AAH22432.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|20380602|gb|AAH27499.1| Small nuclear ribonucleoprotein polypeptide G [Mus musculus] gi|30185984|gb|AAH51470.1| Small nuclear ribonucleoprotein polypeptide G [Mus musculus] gi|42542824|gb|AAH66302.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|47682759|gb|AAH70166.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|48145953|emb|CAG33199.1| SNRPG [Homo sapiens] gi|62420278|gb|AAX81996.1| unknown [Homo sapiens] gi|62948132|gb|AAH94411.1| Small nuclear ribonucleoprotein polypeptide G [Mus musculus] gi|73586825|gb|AAI03237.1| Small nuclear ribonucleoprotein polypeptide G [Bos taurus] gi|76779243|gb|AAI06056.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|119620223|gb|EAW99817.1| small nuclear ribonucleoprotein polypeptide G, isoform CRA_a [Homo sapiens] gi|119620224|gb|EAW99818.1| small nuclear ribonucleoprotein polypeptide G, isoform CRA_a [Homo sapiens] gi|127799349|gb|AAH71880.1| Small nuclear ribonucleoprotein polypeptide G [Homo sapiens] gi|148666745|gb|EDK99161.1| mCG130514, isoform CRA_a [Mus musculus] gi|149036610|gb|EDL91228.1| rCG56468, isoform CRA_b [Rattus norvegicus] gi|197246583|gb|AAI68750.1| Snrpg protein [Rattus norvegicus] gi|208967440|dbj|BAG73734.1| small nuclear ribonucleoprotein polypeptide G [synthetic construct] gi|296477039|tpg|DAA19154.1| TPA: small nuclear ribonucleoprotein polypeptide G-like [Bos taurus] gi|296482417|tpg|DAA24532.1| TPA: small nuclear ribonucleoprotein G [Bos taurus] gi|312153260|gb|ADQ33142.1| small nuclear ribonucleoprotein polypeptide G [synthetic construct] gi|431912604|gb|ELK14622.1| Small nuclear ribonucleoprotein G [Pteropus alecto] gi|537136953|gb|ERE66827.1| small nuclear ribonucleoprotein G-like protein [Cricetulus griseus] gi|649103408|gb|AIC49766.1| SNRPG, partial [synthetic construct] gi|676264766|gb|KFO21111.1| Small nuclear ribonucleoprotein G [Fukomys damarensis] Length = 76 Score = 114 bits (285), Expect = 3e-23 Identities = 55/76 (72%), Positives = 64/76 (84%) Frame = -1 Query: 386 MSKAHPPELKKYMDKKLTFKLNGKRVVNGILRGFDPFMNLVVDEAVEIRRDKTQKTLGIV 207 MSKAHPPELKK+MDKKL+ KLNG R V GILRGFDPFMNLV+DE VE+ Q +G+V Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV 60 Query: 206 VIRGNSIVIMEALERV 159 VIRGNSI+++EALERV Sbjct: 61 VIRGNSIIMLEALERV 76