BLASTX nr result
ID: Ziziphus21_contig00042843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042843 (399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21766.1| Beta-glucan synthesis-associated SKN1 [Macrophomi... 74 4e-11 gb|KKY16880.1| putative beta- glucan synthetase [Diplodia seriata] 69 1e-09 ref|XP_007582324.1| putative beta- glucan synthetase protein [Ne... 63 8e-08 >gb|EKG21766.1| Beta-glucan synthesis-associated SKN1 [Macrophomina phaseolina MS6] Length = 654 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 399 QHPEPYANVNLTRWHQTDYDWPKNSLVHKC 310 QHPEPYANVNLT+WHQTDYDWPKNSLVHKC Sbjct: 617 QHPEPYANVNLTQWHQTDYDWPKNSLVHKC 646 >gb|KKY16880.1| putative beta- glucan synthetase [Diplodia seriata] Length = 645 Score = 68.9 bits (167), Expect = 1e-09 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -1 Query: 396 HPEPYANVNLTRWHQTDYDWPKNSLVHKC 310 HPEPY+N+NLTRWHQTDYDWP+NSLVH+C Sbjct: 611 HPEPYSNINLTRWHQTDYDWPENSLVHEC 639 >ref|XP_007582324.1| putative beta- glucan synthetase protein [Neofusicoccum parvum UCRNP2] gi|485925677|gb|EOD50192.1| putative beta- glucan synthetase protein [Neofusicoccum parvum UCRNP2] Length = 631 Score = 63.2 bits (152), Expect = 8e-08 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 390 EPYANVNLTRWHQTDYDWPKNSLVHKC 310 EPYAN+NLTRWHQTDYDWP+NSL+H C Sbjct: 599 EPYANINLTRWHQTDYDWPQNSLIHDC 625