BLASTX nr result
ID: Ziziphus21_contig00042815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042815 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY18972.1| hypothetical protein UCDDS831_g05604 [Diplodia se... 82 2e-13 ref|XP_007588698.1| hypothetical protein UCRNP2_9470 [Neofusicoc... 72 2e-10 >gb|KKY18972.1| hypothetical protein UCDDS831_g05604 [Diplodia seriata] Length = 427 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -1 Query: 149 HVLAFVTMEPWQSWGLFLALSAVAYFYYSNQKRTTARPTRSQSIIEETA 3 H+LA V MEPWQSWGLFL LS AYFYYS+QK+TTARP RSQS+ EE A Sbjct: 12 HILAPVVMEPWQSWGLFLTLSIAAYFYYSSQKKTTARPARSQSVAEEPA 60 >ref|XP_007588698.1| hypothetical protein UCRNP2_9470 [Neofusicoccum parvum UCRNP2] gi|485916490|gb|EOD43824.1| hypothetical protein UCRNP2_9470 [Neofusicoccum parvum UCRNP2] Length = 423 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 128 MEPWQSWGLFLALSAVAYFYYSNQKRTTARPTRSQSIIEETA 3 MEPWQSWGLFL L AV YFYYSN K+T ARP R Q + EETA Sbjct: 1 MEPWQSWGLFLTLGAVVYFYYSNNKKTAARPARGQPVAEETA 42