BLASTX nr result
ID: Ziziphus21_contig00042781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00042781 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12427.1| hypothetical protein MPH_10544 [Macrophomina phas... 97 5e-18 >gb|EKG12427.1| hypothetical protein MPH_10544 [Macrophomina phaseolina MS6] Length = 458 Score = 97.1 bits (240), Expect = 5e-18 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -3 Query: 298 IRSGGSRPGPKEPHTKEDCLRRHATIRDMFMAAERNWSSVDNVALRPFGTWAVDR 134 IRS RPGP+EPHTKE+CLRRHA +RDMF AAE +WS+ DN A+RPFGTWAVDR Sbjct: 401 IRSAAPRPGPREPHTKENCLRRHAAVRDMFTAAEHDWSAADNAAVRPFGTWAVDR 455