BLASTX nr result
ID: Ziziphus21_contig00041406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041406 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG18955.1| hypothetical protein MPH_03771 [Macrophomina phas... 91 3e-16 gb|KKY22226.1| putative conserved oligomeric golgi complex subun... 89 2e-15 ref|XP_007579527.1| putative conserved oligomeric golgi complex ... 80 8e-13 ref|XP_007778265.1| hypothetical protein W97_02174 [Coniosporium... 65 2e-08 gb|KIW01573.1| hypothetical protein PV09_07047 [Verruconis gallo... 60 5e-07 gb|EMF12241.1| hypothetical protein SEPMUDRAFT_67950 [Sphaerulin... 58 3e-06 ref|XP_007927731.1| hypothetical protein MYCFIDRAFT_215654 [Pseu... 57 7e-06 gb|KEQ59093.1| hypothetical protein M437DRAFT_57717, partial [Au... 56 9e-06 >gb|EKG18955.1| hypothetical protein MPH_03771 [Macrophomina phaseolina MS6] Length = 191 Score = 90.9 bits (224), Expect = 3e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 152 RLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 RLRRLARQYLGVRQI +KIG EHPFLVAQEPRLTK+RNTLLLDLGA LKQ Sbjct: 106 RLRRLARQYLGVRQIVRKIGVEHPFLVAQEPRLTKIRNTLLLDLGAALKQ 155 >gb|KKY22226.1| putative conserved oligomeric golgi complex subunit 2 [Diplodia seriata] Length = 306 Score = 88.6 bits (218), Expect = 2e-15 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELK 6 L RLRRLARQYLGVRQ + +IG EHPFLVAQEPRLTK+RNTLLLDLGAELK Sbjct: 219 LGRLRRLARQYLGVRQTAGRIGKEHPFLVAQEPRLTKIRNTLLLDLGAELK 269 >ref|XP_007579527.1| putative conserved oligomeric golgi complex subunit 2 protein [Neofusicoccum parvum UCRNP2] gi|485929628|gb|EOD52989.1| putative conserved oligomeric golgi complex subunit 2 protein [Neofusicoccum parvum UCRNP2] Length = 205 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -1 Query: 149 LRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 +R+ +YLGVRQI++++G EHPFLVAQEPRLTK+RNTLLLDLGA LKQ Sbjct: 121 MRKAVGEYLGVRQIAERVGVEHPFLVAQEPRLTKIRNTLLLDLGAALKQ 169 >ref|XP_007778265.1| hypothetical protein W97_02174 [Coniosporium apollinis CBS 100218] gi|494825818|gb|EON62948.1| hypothetical protein W97_02174 [Coniosporium apollinis CBS 100218] Length = 291 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 L +L+R +QY+ VRQ++ +G +HPFLVAQ+PR+T+VR+ +LLDL A LKQ Sbjct: 201 LSKLQRQLQQYMVVRQLTDHVGLDHPFLVAQKPRMTRVRSAILLDLSAALKQ 252 >gb|KIW01573.1| hypothetical protein PV09_07047 [Verruconis gallopava] Length = 317 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 +PRL RL YL V Q+ +++G +HPFLV Q+ RL K+R TLLLDL LKQ Sbjct: 227 VPRLERLVMTYLVVLQMIEQVGPDHPFLVKQQVRLDKIRETLLLDLSTALKQ 278 >gb|EMF12241.1| hypothetical protein SEPMUDRAFT_67950 [Sphaerulina musiva SO2202] Length = 303 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 L RL+R A Q+L V ++ ++IG +HPFLVAQ+ RL ++R TLLLDL L+Q Sbjct: 219 LRRLQRHAEQFLMVERLIERIGPDHPFLVAQKGRLDEIRKTLLLDLATALRQ 270 >ref|XP_007927731.1| hypothetical protein MYCFIDRAFT_215654 [Pseudocercospora fijiensis CIRAD86] gi|452982583|gb|EME82342.1| hypothetical protein MYCFIDRAFT_215654 [Pseudocercospora fijiensis CIRAD86] Length = 292 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 L +LRR QYL + ++ ++IG EHPFLV Q R+ ++R T+LLDL A L+Q Sbjct: 208 LGKLRRFTMQYLLIGKMVERIGAEHPFLVKQRGRMEEIRKTILLDLAASLRQ 259 >gb|KEQ59093.1| hypothetical protein M437DRAFT_57717, partial [Aureobasidium melanogenum CBS 110374] Length = 269 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 158 LPRLRRLARQYLGVRQISQKIGTEHPFLVAQEPRLTKVRNTLLLDLGAELKQ 3 L RLRR A+ YL + ++QK+ +HPF+VAQ+ RL +VRNTLLLDL LKQ Sbjct: 185 LSRLRRHAQAYLLLTHLTQKV-LDHPFVVAQQSRLMRVRNTLLLDLRTALKQ 235