BLASTX nr result
ID: Ziziphus21_contig00041363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041363 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY19822.1| putative saccharopine dehydrogenase [Diplodia ser... 58 2e-06 >gb|KKY19822.1| putative saccharopine dehydrogenase [Diplodia seriata] Length = 391 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 269 DKKTTRVWVDAEKLFNEKVATLPEELRKKEA 177 D+KT RVW DAEKLFNEKVATLPE LRKKEA Sbjct: 361 DRKTARVWADAEKLFNEKVATLPEGLRKKEA 391