BLASTX nr result
ID: Ziziphus21_contig00041356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041356 (246 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13790.1| Alpha/beta hydrolase fold-1, partial [Macrophomin... 67 7e-09 ref|XP_007588393.1| putative alpha beta hydrolase fold-1 protein... 65 2e-08 ref|XP_008028910.1| hypothetical protein SETTUDRAFT_155675 [Seto... 64 3e-08 ref|XP_007688232.1| hypothetical protein COCMIDRAFT_26566 [Bipol... 57 4e-06 >gb|EKG13790.1| Alpha/beta hydrolase fold-1, partial [Macrophomina phaseolina MS6] Length = 352 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 244 DLQIKQIDSFHRPMLERPDELALSITHWLVERF 146 DLQIKQIDSFHRPMLE+PDELALSI HWL+E+F Sbjct: 319 DLQIKQIDSFHRPMLEKPDELALSIRHWLIEKF 351 >ref|XP_007588393.1| putative alpha beta hydrolase fold-1 protein [Neofusicoccum parvum UCRNP2] gi|485917006|gb|EOD44133.1| putative alpha beta hydrolase fold-1 protein [Neofusicoccum parvum UCRNP2] Length = 340 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 244 DLQIKQIDSFHRPMLERPDELALSITHWLVERFELQ 137 DLQIKQID FHRPMLERP+ELA+SITHWLVE+ ++ Sbjct: 302 DLQIKQIDGFHRPMLERPEELAMSITHWLVEKLHVR 337 >ref|XP_008028910.1| hypothetical protein SETTUDRAFT_155675 [Setosphaeria turcica Et28A] gi|482806009|gb|EOA83082.1| hypothetical protein SETTUDRAFT_155675 [Setosphaeria turcica Et28A] Length = 334 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 244 DLQIKQIDSFHRPMLERPDELALSITHWLVERFE 143 DLQIKQ+DSFHRPMLE+P+ELA SI HWL+ERF+ Sbjct: 301 DLQIKQVDSFHRPMLEKPEELAWSIQHWLIERFQ 334 >ref|XP_007688232.1| hypothetical protein COCMIDRAFT_26566 [Bipolaris oryzae ATCC 44560] gi|576931702|gb|EUC45258.1| hypothetical protein COCMIDRAFT_26566 [Bipolaris oryzae ATCC 44560] Length = 335 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 244 DLQIKQIDSFHRPMLERPDELALSITHWLVERF 146 DLQIKQ+DSFHRPMLE P+ LA SI HWL+++F Sbjct: 302 DLQIKQLDSFHRPMLEMPENLARSIKHWLIKKF 334