BLASTX nr result
ID: Ziziphus21_contig00041320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041320 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG19046.1| Glutathione S-transferase [Macrophomina phaseolin... 103 7e-20 gb|KKY24840.1| putative glutathione s-transferase [Diplodia seri... 101 3e-19 ref|XP_007585563.1| putative glutathione s-transferase protein [... 98 2e-18 gb|EKG18995.1| Glutathione S-transferase [Macrophomina phaseolin... 76 1e-11 ref|XP_007346191.1| glutathione S-transferase like protein [Auri... 65 2e-08 ref|XP_007344143.1| putative glutathione S-transferase [Auricula... 57 5e-06 >gb|EKG19046.1| Glutathione S-transferase [Macrophomina phaseolina MS6] Length = 163 Score = 103 bits (256), Expect = 7e-20 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAPTSMWTLVE 165 P+PLTGYDGIL+WL+RCS+RPAYKALIEK EKGEDRGVVPTIMAEAPT +W +++ Sbjct: 108 PFPLTGYDGILQWLKRCSERPAYKALIEKGEKGEDRGVVPTIMAEAPTPIWNIIQ 162 >gb|KKY24840.1| putative glutathione s-transferase [Diplodia seriata] Length = 232 Score = 101 bits (251), Expect = 3e-19 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAPTSMWTLVE 165 P+PLTGYDGIL+WL+R ++RPAYKA+IEKAEKGEDRGVVPTIMAEAPT+MW +E Sbjct: 177 PFPLTGYDGILRWLQRLAERPAYKAMIEKAEKGEDRGVVPTIMAEAPTAMWAYLE 231 >ref|XP_007585563.1| putative glutathione s-transferase protein [Neofusicoccum parvum UCRNP2] gi|485921188|gb|EOD46978.1| putative glutathione s-transferase protein [Neofusicoccum parvum UCRNP2] Length = 233 Score = 98.2 bits (243), Expect = 2e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAPTSMWTLVE 165 P+PLTGYDGILKWLERC++RPAYKA+IEKAEK E RGVVPTI AEAP +MW +E Sbjct: 178 PFPLTGYDGILKWLERCTERPAYKAMIEKAEKSETRGVVPTISAEAPQAMWAFLE 232 >gb|EKG18995.1| Glutathione S-transferase [Macrophomina phaseolina MS6] Length = 217 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAPTSMWT 156 P+ LTGYDG+L WL+R S+RPAYKA++EKAE GEDRG PT+ EAP + T Sbjct: 165 PFALTGYDGLLGWLKRASERPAYKAMVEKAETGEDRGEFPTLCVEAPRHITT 216 >ref|XP_007346191.1| glutathione S-transferase like protein [Auricularia subglabra TFB-10046 SS5] gi|393238229|gb|EJD45767.1| glutathione S-transferase like protein [Auricularia subglabra TFB-10046 SS5] Length = 232 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAP 141 P L GYDGIL WL+R QRP YK ++EK E GEDRG P + AEAP Sbjct: 178 PVSLEGYDGILAWLQRVGQRPGYKRMVEKGETGEDRGNFPVLGAEAP 224 >ref|XP_007344143.1| putative glutathione S-transferase [Auricularia subglabra TFB-10046 SS5] gi|393240197|gb|EJD47724.1| putative glutathione S-transferase [Auricularia subglabra TFB-10046 SS5] Length = 230 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +1 Query: 1 PYPLTGYDGILKWLERCSQRPAYKALIEKAEKGEDRGVVPTIMAEAP 141 P+ + G DGI W ++RPAYK IEKAEK E+RGV P + EAP Sbjct: 178 PFEIEGLDGIRTWAGHLAKRPAYKRFIEKAEKAEERGVFPVLCPEAP 224