BLASTX nr result
ID: Ziziphus21_contig00041154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00041154 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583184.1| putative major allergen-like protein, precur... 58 2e-06 >ref|XP_007583184.1| putative major allergen-like protein, precursor [Neofusicoccum parvum UCRNP2] gi|485924574|gb|EOD49343.1| putative major allergen-like protein, precursor [Neofusicoccum parvum UCRNP2] Length = 148 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 256 CHAGGNGADDFVCSQVGDASGTMSERFGTY 167 CHAGGNGADDFVCSQV +A+ T++ERFGTY Sbjct: 119 CHAGGNGADDFVCSQVANATTTLAERFGTY 148