BLASTX nr result
ID: Ziziphus21_contig00040632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00040632 (539 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM51817.1| hypothetical protein LR48_Vigan09g047600 [Vigna a... 71 3e-10 >gb|KOM51817.1| hypothetical protein LR48_Vigan09g047600 [Vigna angularis] Length = 265 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 30 PLMFFRLIIFRKERKRRGSPRMGKPTIERSDHTILIEETR 149 PLMFFRL+++RKER+RRGSPR GKP IERSDHTILI+ TR Sbjct: 23 PLMFFRLLLYRKERQRRGSPRTGKPMIERSDHTILIDPTR 62