BLASTX nr result
ID: Ziziphus21_contig00039695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039695 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010245939.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-16 ref|XP_010648799.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-15 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 77 2e-15 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 77 2e-15 ref|XP_004501417.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-15 ref|XP_012571541.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-15 ref|XP_007136902.1| hypothetical protein PHAVU_009G083700g [Phas... 73 5e-15 ref|XP_006581311.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-15 ref|XP_003603234.1| pentatricopeptide (PPR) repeat protein [Medi... 74 5e-15 gb|KHN37229.1| Pentatricopeptide repeat-containing protein [Glyc... 74 5e-15 ref|XP_009362951.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-14 ref|XP_008393567.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-14 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 74 1e-14 ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-14 gb|KHN29666.1| Pentatricopeptide repeat-containing protein [Glyc... 73 1e-14 ref|XP_012077175.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-14 gb|KDP34011.1| hypothetical protein JCGZ_07582 [Jatropha curcas] 75 1e-14 ref|NP_195043.1| pentatricopeptide repeat-containing protein [Ar... 73 2e-14 ref|XP_010447274.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-14 ref|XP_010437793.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-14 >ref|XP_010245939.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 isoform X1 [Nelumbo nucifera] Length = 1000 Score = 77.8 bits (190), Expect(2) = 1e-16 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +REI LRDA+RFH FRDGI S DYW Sbjct: 958 RVCGDCHNAIKYISKVTRREIVLRDANRFHYFRDGICSCGDYW 1000 Score = 35.0 bits (79), Expect(2) = 1e-16 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTPP TT+RVIKNL+ Sbjct: 941 GLISTPPATTIRVIKNLR 958 >ref|XP_010648799.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1597 Score = 76.6 bits (187), Expect(2) = 2e-15 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +REI LRDA+RFH FRDG+ S DYW Sbjct: 1555 RVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 1597 Score = 32.3 bits (72), Expect(2) = 2e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTP +TT+RVIKNL+ Sbjct: 1538 GLISTPASTTIRVIKNLR 1555 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 76.6 bits (187), Expect(2) = 2e-15 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +REI LRDA+RFH FRDG+ S DYW Sbjct: 823 RVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 865 Score = 32.3 bits (72), Expect(2) = 2e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTP +TT+RVIKNL+ Sbjct: 806 GLISTPASTTIRVIKNLR 823 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 76.6 bits (187), Expect(2) = 2e-15 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +REI LRDA+RFH FRDG+ S DYW Sbjct: 461 RVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 503 Score = 32.3 bits (72), Expect(2) = 2e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTP +TT+RVIKNL+ Sbjct: 444 GLISTPASTTIRVIKNLR 461 >ref|XP_004501417.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 isoform X2 [Cicer arietinum] gi|502132556|ref|XP_004501418.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 isoform X1 [Cicer arietinum] Length = 992 Score = 74.7 bits (182), Expect(2) = 3e-15 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV QREI LRDA+RFH F+ GI S DYW Sbjct: 950 RVCGDCHNAIKYISKVFQREIVLRDANRFHHFKSGICSCGDYW 992 Score = 33.5 bits (75), Expect(2) = 3e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 933 GLMKTPPSTTLRVIKNLR 950 >ref|XP_012571541.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 isoform X3 [Cicer arietinum] Length = 960 Score = 74.7 bits (182), Expect(2) = 3e-15 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV QREI LRDA+RFH F+ GI S DYW Sbjct: 918 RVCGDCHNAIKYISKVFQREIVLRDANRFHHFKSGICSCGDYW 960 Score = 33.5 bits (75), Expect(2) = 3e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 901 GLMKTPPSTTLRVIKNLR 918 >ref|XP_007136902.1| hypothetical protein PHAVU_009G083700g [Phaseolus vulgaris] gi|561009989|gb|ESW08896.1| hypothetical protein PHAVU_009G083700g [Phaseolus vulgaris] Length = 988 Score = 72.8 bits (177), Expect(2) = 5e-15 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYIS+V +REI LRDA+RFH FR GI S DYW Sbjct: 946 RVCGDCHNAIKYISEVFKREIVLRDANRFHHFRSGICSCGDYW 988 Score = 34.7 bits (78), Expect(2) = 5e-15 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLI TPP+TTLRVIKNL+ Sbjct: 929 GLIKTPPSTTLRVIKNLR 946 >ref|XP_006581311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] gi|947103892|gb|KRH52275.1| hypothetical protein GLYMA_06G057900 [Glycine max] Length = 981 Score = 73.9 bits (180), Expect(2) = 5e-15 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +RE+ LRDA+RFH FR G+ S DYW Sbjct: 939 RVCGDCHNAIKYISKVFEREVVLRDANRFHHFRSGVCSCGDYW 981 Score = 33.5 bits (75), Expect(2) = 5e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 922 GLMKTPPSTTLRVIKNLR 939 >ref|XP_003603234.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355492282|gb|AES73485.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 973 Score = 73.9 bits (180), Expect(2) = 5e-15 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYIS V QREI LRDA+RFH FR GI S DYW Sbjct: 931 RVCGDCHNAIKYISNVFQREIVLRDANRFHHFRSGICSCGDYW 973 Score = 33.5 bits (75), Expect(2) = 5e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 914 GLMKTPPSTTLRVIKNLR 931 >gb|KHN37229.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 847 Score = 73.9 bits (180), Expect(2) = 5e-15 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIKYISKV +RE+ LRDA+RFH FR G+ S DYW Sbjct: 805 RVCGDCHNAIKYISKVFEREVVLRDANRFHHFRSGVCSCGDYW 847 Score = 33.5 bits (75), Expect(2) = 5e-15 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 788 GLMKTPPSTTLRVIKNLR 805 >ref|XP_009362951.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Pyrus x bretschneideri] Length = 1011 Score = 74.7 bits (182), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYISKV QREI LRDA+RFH F+DG S DYW Sbjct: 969 RVCGDCHNAVKYISKVYQREIVLRDANRFHRFKDGTCSCGDYW 1011 Score = 31.6 bits (70), Expect(2) = 1e-14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTPP+ +RVIKNL+ Sbjct: 952 GLISTPPSAAIRVIKNLR 969 >ref|XP_008393567.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Malus domestica] Length = 1011 Score = 74.7 bits (182), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYISKV QREI LRDA+RFH F+DG S DYW Sbjct: 969 RVCGDCHNAVKYISKVYQREIVLRDANRFHRFKDGTCSCGDYW 1011 Score = 31.6 bits (70), Expect(2) = 1e-14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GLISTPP+ +RVIKNL+ Sbjct: 952 GLISTPPSAAIRVIKNLR 969 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 73.9 bits (180), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYISKV REI LRDA+RFH F+DGI S DYW Sbjct: 955 RVCGDCHNAMKYISKVYDREIVLRDANRFHRFKDGICSCGDYW 997 Score = 32.3 bits (72), Expect(2) = 1e-14 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP+T +RVIKNL+ Sbjct: 938 GLLSTPPSTPIRVIKNLR 955 >ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] gi|947113302|gb|KRH61604.1| hypothetical protein GLYMA_04G057300 [Glycine max] Length = 980 Score = 72.8 bits (177), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCH+AIKYISKV +REI LRDA+RFH FR+GI S DYW Sbjct: 938 RVCGDCHSAIKYISKVFKREIVLRDANRFHHFRNGICSCGDYW 980 Score = 33.5 bits (75), Expect(2) = 1e-14 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 921 GLMKTPPSTTLRVIKNLR 938 >gb|KHN29666.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 843 Score = 72.8 bits (177), Expect(2) = 1e-14 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCH+AIKYISKV +REI LRDA+RFH FR+GI S DYW Sbjct: 801 RVCGDCHSAIKYISKVFKREIVLRDANRFHHFRNGICSCGDYW 843 Score = 33.5 bits (75), Expect(2) = 1e-14 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+ TPP+TTLRVIKNL+ Sbjct: 784 GLMKTPPSTTLRVIKNLR 801 >ref|XP_012077175.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Jatropha curcas] Length = 1007 Score = 75.1 bits (183), Expect(2) = 1e-14 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIK++SK+ QREI LRDA+RFHCF++G S DYW Sbjct: 965 RVCGDCHNAIKFVSKIYQREIVLRDANRFHCFKNGSCSCGDYW 1007 Score = 30.8 bits (68), Expect(2) = 1e-14 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP++ +RVIKNL+ Sbjct: 948 GLLSTPPSSRIRVIKNLR 965 >gb|KDP34011.1| hypothetical protein JCGZ_07582 [Jatropha curcas] Length = 915 Score = 75.1 bits (183), Expect(2) = 1e-14 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNAIK++SK+ QREI LRDA+RFHCF++G S DYW Sbjct: 873 RVCGDCHNAIKFVSKIYQREIVLRDANRFHCFKNGSCSCGDYW 915 Score = 30.8 bits (68), Expect(2) = 1e-14 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP++ +RVIKNL+ Sbjct: 856 GLLSTPPSSRIRVIKNLR 873 >ref|NP_195043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206840|sp|Q9SMZ2.1|PP347_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33170 gi|4455331|emb|CAB36791.1| putative protein [Arabidopsis thaliana] gi|7270265|emb|CAB80034.1| putative protein [Arabidopsis thaliana] gi|332660786|gb|AEE86186.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 990 Score = 72.8 bits (177), Expect(2) = 2e-14 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYI+KV REI LRDA+RFH F+DGI S DYW Sbjct: 948 RVCGDCHNAMKYIAKVYNREIVLRDANRFHRFKDGICSCGDYW 990 Score = 32.3 bits (72), Expect(2) = 2e-14 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP+T +RVIKNL+ Sbjct: 931 GLLSTPPSTPIRVIKNLR 948 >ref|XP_010447274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Camelina sativa] Length = 998 Score = 72.8 bits (177), Expect(2) = 3e-14 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYI+KV REI LRDA+RFH F+DGI S DYW Sbjct: 956 RVCGDCHNAMKYIAKVYDREIVLRDANRFHRFKDGICSCGDYW 998 Score = 32.0 bits (71), Expect(2) = 3e-14 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP+T +RVIKNL+ Sbjct: 939 GLMSTPPSTPIRVIKNLR 956 >ref|XP_010437793.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Camelina sativa] Length = 997 Score = 72.8 bits (177), Expect(2) = 3e-14 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 335 RVCGDCHNAIKYISKVAQREIALRDADRFHCFRDGIRSFRDYW 207 RVCGDCHNA+KYI+KV REI LRDA+RFH F+DGI S DYW Sbjct: 955 RVCGDCHNAMKYIAKVYDREIVLRDANRFHRFKDGICSCGDYW 997 Score = 32.0 bits (71), Expect(2) = 3e-14 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 388 GLISTPPTTTLRVIKNLK 335 GL+STPP+T +RVIKNL+ Sbjct: 938 GLMSTPPSTPIRVIKNLR 955