BLASTX nr result
ID: Ziziphus21_contig00039621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039621 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB48506.1| hypothetical protein B456_008G072800 [Gossypium r... 64 4e-08 ref|XP_006425820.1| hypothetical protein CICLE_v10026393mg [Citr... 63 1e-07 ref|XP_013593883.1| PREDICTED: uncharacterized protein LOC106301... 62 2e-07 ref|XP_008776242.1| PREDICTED: autophagy-related protein 101-lik... 60 5e-07 ref|XP_008776239.1| PREDICTED: meiotically up-regulated gene 66 ... 60 5e-07 ref|XP_012436984.1| PREDICTED: meiotically up-regulated gene 66 ... 60 8e-07 ref|XP_012436985.1| PREDICTED: meiotically up-regulated gene 66 ... 60 8e-07 gb|KHG24008.1| hypothetical protein F383_06361 [Gossypium arboreum] 60 8e-07 gb|KHG24007.1| mug66 [Gossypium arboreum] 60 8e-07 ref|XP_009366401.1| PREDICTED: uncharacterized protein LOC103956... 60 8e-07 ref|XP_008339624.1| PREDICTED: autophagy-related protein 101 [Ma... 60 8e-07 ref|XP_008241561.1| PREDICTED: autophagy-related protein 101 [Pr... 60 8e-07 ref|XP_002522341.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 ref|XP_007047149.1| Uncharacterized protein isoform 2 [Theobroma... 60 8e-07 ref|XP_007047148.1| Uncharacterized protein isoform 1 [Theobroma... 60 8e-07 ref|XP_007202364.1| hypothetical protein PRUPE_ppa009212mg [Prun... 60 8e-07 ref|XP_009348088.1| PREDICTED: uncharacterized protein LOC103939... 59 1e-06 gb|KFK28369.1| hypothetical protein AALP_AA8G506500 [Arabis alpina] 59 1e-06 ref|XP_002270399.2| PREDICTED: uncharacterized protein LOC100265... 59 1e-06 dbj|BAB08635.1| unnamed protein product [Arabidopsis thaliana] 59 1e-06 >gb|KJB48506.1| hypothetical protein B456_008G072800 [Gossypium raimondii] Length = 197 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 IAGILHTIVFHRALGLVRPKDVDLELFEITY 3 +AGILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 2 MAGILHTIVFHRALGLVRPKDVDLELFEITY 32 >ref|XP_006425820.1| hypothetical protein CICLE_v10026393mg [Citrus clementina] gi|568824544|ref|XP_006466657.1| PREDICTED: autophagy-related protein 101-like isoform X1 [Citrus sinensis] gi|557527810|gb|ESR39060.1| hypothetical protein CICLE_v10026393mg [Citrus clementina] Length = 235 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 92 AGILHTIVFHRALGLVRPKDVDLELFEITY 3 AGILHTI+FHRALGLVRPKD+DLELFEITY Sbjct: 41 AGILHTIIFHRALGLVRPKDIDLELFEITY 70 >ref|XP_013593883.1| PREDICTED: uncharacterized protein LOC106301940 isoform X2 [Brassica oleracea var. oleracea] Length = 211 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 92 AGILHTIVFHRALGLVRPKDVDLELFEITY 3 AGILHTIVFHRALGL+RPKD+DLELF+ITY Sbjct: 21 AGILHTIVFHRALGLIRPKDIDLELFDITY 50 >ref|XP_008776242.1| PREDICTED: autophagy-related protein 101-like isoform X2 [Phoenix dactylifera] Length = 183 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 92 AGILHTIVFHRALGLVRPKDVDLELFEITY 3 AGILHTIVFHRALGLVRPKDVD ELF+ITY Sbjct: 13 AGILHTIVFHRALGLVRPKDVDCELFDITY 42 >ref|XP_008776239.1| PREDICTED: meiotically up-regulated gene 66 protein-like isoform X1 [Phoenix dactylifera] gi|672194233|ref|XP_008776241.1| PREDICTED: meiotically up-regulated gene 66 protein-like isoform X1 [Phoenix dactylifera] Length = 209 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 92 AGILHTIVFHRALGLVRPKDVDLELFEITY 3 AGILHTIVFHRALGLVRPKDVD ELF+ITY Sbjct: 13 AGILHTIVFHRALGLVRPKDVDCELFDITY 42 >ref|XP_012436984.1| PREDICTED: meiotically up-regulated gene 66 protein isoform X1 [Gossypium raimondii] gi|763781437|gb|KJB48508.1| hypothetical protein B456_008G072800 [Gossypium raimondii] Length = 217 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_012436985.1| PREDICTED: meiotically up-regulated gene 66 protein isoform X2 [Gossypium raimondii] gi|763781436|gb|KJB48507.1| hypothetical protein B456_008G072800 [Gossypium raimondii] Length = 196 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >gb|KHG24008.1| hypothetical protein F383_06361 [Gossypium arboreum] Length = 196 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >gb|KHG24007.1| mug66 [Gossypium arboreum] Length = 217 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_009366401.1| PREDICTED: uncharacterized protein LOC103956178 [Pyrus x bretschneideri] Length = 219 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_008339624.1| PREDICTED: autophagy-related protein 101 [Malus domestica] Length = 219 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_008241561.1| PREDICTED: autophagy-related protein 101 [Prunus mume] Length = 219 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_002522341.1| conserved hypothetical protein [Ricinus communis] gi|223538419|gb|EEF40025.1| conserved hypothetical protein [Ricinus communis] Length = 205 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDVDLELFEITY 52 >ref|XP_007047149.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508699410|gb|EOX91306.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 202 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 30 ILHTIVFHRALGLVRPKDVDLELFEITY 57 >ref|XP_007047148.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508699409|gb|EOX91305.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 223 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 30 ILHTIVFHRALGLVRPKDVDLELFEITY 57 >ref|XP_007202364.1| hypothetical protein PRUPE_ppa009212mg [Prunus persica] gi|462397895|gb|EMJ03563.1| hypothetical protein PRUPE_ppa009212mg [Prunus persica] Length = 302 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKDVDLELFEITY Sbjct: 108 ILHTIVFHRALGLVRPKDVDLELFEITY 135 >ref|XP_009348088.1| PREDICTED: uncharacterized protein LOC103939703 [Pyrus x bretschneideri] Length = 216 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKD+DLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDIDLELFEITY 52 >gb|KFK28369.1| hypothetical protein AALP_AA8G506500 [Arabis alpina] Length = 218 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGL+RPKDVDLELFEITY Sbjct: 25 ILHTIVFHRALGLIRPKDVDLELFEITY 52 >ref|XP_002270399.2| PREDICTED: uncharacterized protein LOC100265795 [Vitis vinifera] gi|297735844|emb|CBI18564.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGLVRPKD+DLELFEITY Sbjct: 25 ILHTIVFHRALGLVRPKDIDLELFEITY 52 >dbj|BAB08635.1| unnamed protein product [Arabidopsis thaliana] Length = 255 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 ILHTIVFHRALGLVRPKDVDLELFEITY 3 ILHTIVFHRALGL+RPKD+DLELFEITY Sbjct: 76 ILHTIVFHRALGLIRPKDIDLELFEITY 103