BLASTX nr result
ID: Ziziphus21_contig00039558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00039558 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010756915.1| ADP,ATP carrier protein [Paracoccidioides br... 67 7e-09 ref|XP_007737962.1| ADP,ATP carrier protein [Capronia epimyces C... 67 7e-09 gb|EWC48323.1| ADP,ATP carrier protein [Drechslerella stenobroch... 67 7e-09 ref|XP_007802937.1| ADP, ATP carrier protein [Endocarpon pusillu... 67 7e-09 ref|XP_011117860.1| hypothetical protein AOL_s00006g249 [Arthrob... 67 7e-09 ref|XP_002625109.1| ADP/ATP carrier protein [Blastomyces gilchri... 67 7e-09 ref|XP_002542493.1| ADP,ATP carrier protein [Uncinocarpus reesii... 67 7e-09 ref|XP_002789451.1| ADP/ATP carrier protein [Paracoccidioides lu... 67 7e-09 ref|XP_013271822.1| ADP,ATP carrier protein [Rhinocladiella mack... 66 1e-08 ref|XP_013313020.1| ADP,ATP carrier protein [Exophiala xenobioti... 66 1e-08 gb|KIW44148.1| ADP,ATP carrier protein [Exophiala oligosperma] 66 1e-08 gb|KIW13384.1| ADP,ATP carrier protein [Exophiala spinifera] 66 1e-08 gb|KIW06207.1| ADP,ATP carrier protein [Verruconis gallopava] 66 1e-08 gb|KIV78936.1| ADP,ATP carrier protein [Exophiala sideris] 66 1e-08 gb|EEH05039.1| ADP,ATP carrier protein [Histoplasma capsulatum G... 66 1e-08 emb|CCX09646.1| Similar to ADP,ATP carrier protein; acc. no. P02... 66 1e-08 gb|EGC41068.1| ADP,ATP carrier protein [Histoplasma capsulatum H88] 66 1e-08 ref|XP_001538678.1| ADP/ATP carrier protein [Histoplasma capsula... 66 1e-08 gb|KKY37930.1| putative carrier protein [Diaporthe ampelina] 65 2e-08 ref|XP_011115865.1| hypothetical protein H072_10403 [Dactylellin... 65 2e-08 >ref|XP_010756915.1| ADP,ATP carrier protein [Paracoccidioides brasiliensis Pb18] gi|225682410|gb|EEH20694.1| ADP,ATP carrier protein [Paracoccidioides brasiliensis Pb03] gi|699751759|gb|EEH45290.2| ADP,ATP carrier protein [Paracoccidioides brasiliensis Pb18] Length = 309 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 277 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 309 >ref|XP_007737962.1| ADP,ATP carrier protein [Capronia epimyces CBS 606.96] gi|590002234|gb|EXJ77452.1| ADP,ATP carrier protein [Capronia epimyces CBS 606.96] Length = 267 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 231 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 263 >gb|EWC48323.1| ADP,ATP carrier protein [Drechslerella stenobrocha 248] Length = 306 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 270 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 302 >ref|XP_007802937.1| ADP, ATP carrier protein [Endocarpon pusillum Z07020] gi|539434980|gb|ERF71418.1| ADP, ATP carrier protein [Endocarpon pusillum Z07020] Length = 316 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 312 >ref|XP_011117860.1| hypothetical protein AOL_s00006g249 [Arthrobotrys oligospora ATCC 24927] gi|345570562|gb|EGX53383.1| hypothetical protein AOL_s00006g249 [Arthrobotrys oligospora ATCC 24927] Length = 306 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 270 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 302 >ref|XP_002625109.1| ADP/ATP carrier protein [Blastomyces gilchristii SLH14081] gi|239595739|gb|EEQ78320.1| ADP,ATP carrier protein [Blastomyces gilchristii SLH14081] gi|239606731|gb|EEQ83718.1| ADP,ATP carrier protein [Blastomyces dermatitidis ER-3] gi|327354953|gb|EGE83810.1| ADP,ATP carrier protein [Blastomyces dermatitidis ATCC 18188] gi|531983586|gb|EQL34173.1| ADP,ATP carrier protein [Blastomyces dermatitidis ATCC 26199] Length = 311 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 279 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 311 >ref|XP_002542493.1| ADP,ATP carrier protein [Uncinocarpus reesii 1704] gi|237902759|gb|EEP77160.1| ADP,ATP carrier protein [Uncinocarpus reesii 1704] Length = 269 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 233 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 265 >ref|XP_002789451.1| ADP/ATP carrier protein [Paracoccidioides lutzii Pb01] gi|226283785|gb|EEH39351.1| ADP,ATP carrier protein [Paracoccidioides lutzii Pb01] Length = 309 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK Sbjct: 277 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 309 >ref|XP_013271822.1| ADP,ATP carrier protein [Rhinocladiella mackenziei CBS 650.93] gi|759328358|gb|KIX04686.1| ADP,ATP carrier protein [Rhinocladiella mackenziei CBS 650.93] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLL+FGKAFK Sbjct: 231 KGAGANILRGVAGAGVLSIYDQVQLLMFGKAFK 263 >ref|XP_013313020.1| ADP,ATP carrier protein [Exophiala xenobiotica] gi|759275929|gb|KIW52436.1| ADP,ATP carrier protein [Exophiala xenobiotica] Length = 320 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLL+FGKAFK Sbjct: 284 KGAGANILRGVAGAGVLSIYDQVQLLMFGKAFK 316 >gb|KIW44148.1| ADP,ATP carrier protein [Exophiala oligosperma] Length = 320 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLL+FGKAFK Sbjct: 284 KGAGANILRGVAGAGVLSIYDQVQLLMFGKAFK 316 >gb|KIW13384.1| ADP,ATP carrier protein [Exophiala spinifera] Length = 318 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLL+FGKAFK Sbjct: 282 KGAGANILRGVAGAGVLSIYDQVQLLMFGKAFK 314 >gb|KIW06207.1| ADP,ATP carrier protein [Verruconis gallopava] Length = 325 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQL+LFGKAFK Sbjct: 289 KGAGANILRGVAGAGVLSIYDQVQLILFGKAFK 321 >gb|KIV78936.1| ADP,ATP carrier protein [Exophiala sideris] Length = 319 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLL+FGKAFK Sbjct: 283 KGAGANILRGVAGAGVLSIYDQVQLLMFGKAFK 315 >gb|EEH05039.1| ADP,ATP carrier protein [Histoplasma capsulatum G186AR] Length = 311 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQL+LFGKAFK Sbjct: 279 KGAGANILRGVAGAGVLSIYDQVQLILFGKAFK 311 >emb|CCX09646.1| Similar to ADP,ATP carrier protein; acc. no. P02723 [Pyronema omphalodes CBS 100304] Length = 306 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLS+YDQVQLLLFGKAFK Sbjct: 274 KGAGANILRGVAGAGVLSLYDQVQLLLFGKAFK 306 >gb|EGC41068.1| ADP,ATP carrier protein [Histoplasma capsulatum H88] Length = 311 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQL+LFGKAFK Sbjct: 279 KGAGANILRGVAGAGVLSIYDQVQLILFGKAFK 311 >ref|XP_001538678.1| ADP/ATP carrier protein [Histoplasma capsulatum NAm1] gi|150415118|gb|EDN10480.1| hypothetical protein HCAG_06283 [Histoplasma capsulatum NAm1] Length = 311 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQL+LFGKAFK Sbjct: 279 KGAGANILRGVAGAGVLSIYDQVQLILFGKAFK 311 >gb|KKY37930.1| putative carrier protein [Diaporthe ampelina] Length = 315 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQ+QLLLFGKAFK Sbjct: 279 KGAGANILRGVAGAGVLSIYDQLQLLLFGKAFK 311 >ref|XP_011115865.1| hypothetical protein H072_10403 [Dactylellina haptotyla CBS 200.50] gi|526194099|gb|EPS36015.1| hypothetical protein H072_10403 [Dactylellina haptotyla CBS 200.50] Length = 306 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 280 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAFK 182 KGAGANILRGVAGAGVLSIYDQVQLLLFGKA+K Sbjct: 270 KGAGANILRGVAGAGVLSIYDQVQLLLFGKAYK 302