BLASTX nr result
ID: Ziziphus21_contig00038498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038498 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007008812.1| NB-ARC domain-containing disease resistance ... 57 4e-06 ref|XP_010657548.1| PREDICTED: putative disease resistance RPP13... 57 5e-06 gb|KDO39634.1| hypothetical protein CISIN_1g040015mg, partial [C... 57 5e-06 ref|XP_006432353.1| hypothetical protein CICLE_v10000029mg [Citr... 56 9e-06 ref|XP_010645124.1| PREDICTED: putative disease resistance RPP13... 56 9e-06 >ref|XP_007008812.1| NB-ARC domain-containing disease resistance protein, putative [Theobroma cacao] gi|508725725|gb|EOY17622.1| NB-ARC domain-containing disease resistance protein, putative [Theobroma cacao] Length = 184 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 150 VGIGFLSASLQLLFHRMASREFVDFVRRSKL-DNLLNKLKMVLLSASELLN 1 VG FLSA LQ+LF RMASRE +DF+R KL D+LL KLK++L+S +LN Sbjct: 5 VGGAFLSAFLQVLFDRMASREVIDFIRGKKLTDDLLKKLKILLISVDTVLN 55 >ref|XP_010657548.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Length = 1292 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 150 VGIGFLSASLQLLFHRMASREFVDFVR-RSKLDNLLNKLKMVLLSASELLN 1 VG FLSASLQ+LF RMASRE V+F+R + K D LLNKLK+ LL+ +LN Sbjct: 6 VGGAFLSASLQVLFDRMASREVVNFIRGQKKNDTLLNKLKITLLTVHVVLN 56 >gb|KDO39634.1| hypothetical protein CISIN_1g040015mg, partial [Citrus sinensis] Length = 1399 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -3 Query: 150 VGIGFLSASLQLLFHRMASREFVDFVRRSKLDNLLNKLKMVLLSASELLN 1 VG FLSA LQ+LF R+ASREF++ +R K D+LL KLK+ LL+ + LLN Sbjct: 3 VGEAFLSAFLQVLFDRLASREFLNLLRSRKYDDLLEKLKITLLTVTALLN 52 >ref|XP_006432353.1| hypothetical protein CICLE_v10000029mg [Citrus clementina] gi|557534475|gb|ESR45593.1| hypothetical protein CICLE_v10000029mg [Citrus clementina] Length = 1458 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 150 VGIGFLSASLQLLFHRMASREFVDFVRRSKLDNLLNKLKMVLLSASELLN 1 VG FLSA LQ+LF R+ASREF++ +R K D LL KLK+ LL+ + LLN Sbjct: 3 VGEAFLSAFLQVLFDRLASREFLNLLRGRKYDGLLEKLKITLLTVTALLN 52 >ref|XP_010645124.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434611|ref|XP_010645125.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434613|ref|XP_010645126.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434615|ref|XP_010645127.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434617|ref|XP_010645128.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434619|ref|XP_010645129.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434621|ref|XP_010645130.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|731434623|ref|XP_010645131.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] gi|147772086|emb|CAN60242.1| hypothetical protein VITISV_018142 [Vitis vinifera] Length = 1445 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 150 VGIGFLSASLQLLFHRMASREFVDFVRRSKLDNLLNKLKMVLLSASELLN 1 VG FLSA LQ+LF R+ASREFV+ +R KLD +L KLK+ LL + +LN Sbjct: 3 VGEAFLSAFLQVLFDRLASREFVELLRGRKLDEVLEKLKITLLMITAVLN 52