BLASTX nr result
ID: Ziziphus21_contig00038479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038479 (808 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535172.1| conserved hypothetical protein [Ricinus comm... 69 4e-09 ref|XP_002518258.1| conserved hypothetical protein [Ricinus comm... 64 1e-07 >ref|XP_002535172.1| conserved hypothetical protein [Ricinus communis] gi|223523836|gb|EEF27212.1| conserved hypothetical protein, partial [Ricinus communis] Length = 86 Score = 68.9 bits (167), Expect = 4e-09 Identities = 34/64 (53%), Positives = 42/64 (65%) Frame = -1 Query: 472 RELEERRKKSKQRVYKSNGRRMADTLTAFETIKYNPSGLTPGADPNRKALDGLRASEIKK 293 RE R K+ +QR+YKSNG RMADTLTAF+T KYNPSGLTP P K + K+ Sbjct: 21 RERTGREKEKEQRIYKSNGIRMADTLTAFDTKKYNPSGLTPPGGPQPKGARRTKGKRDKE 80 Query: 292 AAGP 281 ++ P Sbjct: 81 SSWP 84 >ref|XP_002518258.1| conserved hypothetical protein [Ricinus communis] gi|223542605|gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 64.3 bits (155), Expect = 1e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 252 SNENKESFWARQERNSPFDTKG**LLSGDDLVKGIYERRFSNR 124 + NK+SFWARQERNSPFDTK L++GDDLVKGIYER R Sbjct: 117 TKSNKDSFWARQERNSPFDTKRQELIAGDDLVKGIYERSAGTR 159