BLASTX nr result
ID: Ziziphus21_contig00038394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038394 (425 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 110 3e-22 prf||1211235CE ORF 79 81 3e-13 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 81 3e-13 ref|YP_054682.1| hypothetical protein SaofCp076 (chloroplast) [S... 57 3e-10 ref|YP_003208238.1| hypothetical protein ColajoC_p076 (chloropla... 55 9e-10 ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta refl... 67 5e-09 gb|KQJ96841.1| hypothetical protein BRADI_3g27343, partial [Brac... 50 3e-07 gb|KQJ88603.1| hypothetical protein BRADI_4g19726, partial [Brac... 50 3e-07 ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia olerac... 60 5e-07 gb|KQJ95761.1| hypothetical protein BRADI_3g18879, partial [Brac... 48 9e-06 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 110 bits (276), Expect = 3e-22 Identities = 55/64 (85%), Positives = 59/64 (92%) Frame = -2 Query: 370 MEYMTKVEC*SISIDRSCHIGPNRTSNCFDLNYPEGALSYIYILYQKDGQSNLFLDSIEA 191 MEYMTKVEC SISIDRSCHIGP++TSNCFDLNYPE ALS ILYQK+GQSNLFLDSIEA Sbjct: 1 MEYMTKVECWSISIDRSCHIGPSQTSNCFDLNYPEDALS---ILYQKNGQSNLFLDSIEA 57 Query: 190 QRGE 179 +RGE Sbjct: 58 KRGE 61 >prf||1211235CE ORF 79 Length = 79 Score = 81.3 bits (199), Expect = 3e-13 Identities = 42/57 (73%), Positives = 46/57 (80%) Frame = -2 Query: 334 SIDRSCHIGPNRTSNCFDLNYPEGALSYIYILYQKDGQSNLFLDSIEAQRGEVNRVP 164 SIDRSCHIGP+ TSNCFDLNYPE A+ I YQKDGQSNLFLDS++ EVNRVP Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDI---YQKDGQSNLFLDSLK----EVNRVP 60 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] gi|11466029|ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] gi|78102586|ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] gi|78102613|ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] gi|81301616|ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] gi|81301643|ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] gi|351653909|ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653954|ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|4388760|emb|CAA77389.1| hypothetical protein [Nicotiana tabacum] gi|4388762|emb|CAA77404.1| hypothetical protein [Nicotiana tabacum] gi|77799613|dbj|BAE46702.1| hypothetical protein [Nicotiana sylvestris] gi|77799640|dbj|BAE46729.1| hypothetical protein [Nicotiana sylvestris] gi|80750975|dbj|BAE48051.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751002|dbj|BAE48078.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453935|gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453980|gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454046|gb|AEO95703.1| hypothetical protein [synthetic construct] gi|347454089|gb|AEO95746.1| hypothetical protein [synthetic construct] Length = 79 Score = 81.3 bits (199), Expect = 3e-13 Identities = 42/57 (73%), Positives = 46/57 (80%) Frame = -2 Query: 334 SIDRSCHIGPNRTSNCFDLNYPEGALSYIYILYQKDGQSNLFLDSIEAQRGEVNRVP 164 SIDRSCHIGP+ TSNCFDLNYPE A+ I YQKDGQSNLFLDS++ EVNRVP Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDI---YQKDGQSNLFLDSLK----EVNRVP 60 >ref|YP_054682.1| hypothetical protein SaofCp076 (chloroplast) [Saccharum hybrid cultivar NCo 310] gi|50812610|ref|YP_054711.1| hypothetical protein SaofCp105 (chloroplast) [Saccharum hybrid cultivar NCo 310] gi|49659564|dbj|BAD27345.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gi|49659594|dbj|BAD27375.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gi|413917696|gb|AFW57628.1| hypothetical protein ZEAMMB73_740841 [Zea mays] gi|413936908|gb|AFW71459.1| hypothetical protein ZEAMMB73_969541 [Zea mays] Length = 69 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 181 HLFGLLLNREIGLIVHLFDIIYKYKIRHPPDNSNRSNWMSDSGLY 315 HLFGLLLNREIGL + L I IR P DN+NRS MSDSGLY Sbjct: 2 HLFGLLLNREIGLYIFLILISILIHIRCPTDNANRSYLMSDSGLY 46 Score = 34.3 bits (77), Expect(2) = 3e-10 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 318 HDRSIEIL*HSTFVIYSIHH 377 +DRSIEIL STFVIYSI+H Sbjct: 48 YDRSIEILQDSTFVIYSIYH 67 >ref|YP_003208238.1| hypothetical protein ColajoC_p076 (chloroplast) [Coix lacryma-jobi] gi|260677402|ref|YP_003208264.1| hypothetical protein ColajoC_p102 (chloroplast) [Coix lacryma-jobi] gi|209361329|gb|ACI43244.1| unknown (chloroplast) [Coix lacryma-jobi] gi|209361340|gb|ACI43255.1| unknown (chloroplast) [Coix lacryma-jobi] Length = 69 Score = 55.5 bits (132), Expect(2) = 9e-10 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +1 Query: 181 HLFGLLLNREIGLIVHLFDIIYKYKIRHPPDNSNRSNWMSDSGLY 315 HLFGLLLNREIGL + I IR P DN+NRS MSDSGLY Sbjct: 2 HLFGLLLNREIGLYIFFILISILIHIRCPTDNANRSYLMSDSGLY 46 Score = 34.3 bits (77), Expect(2) = 9e-10 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 318 HDRSIEIL*HSTFVIYSIHH 377 +DRSIEIL STFVIYSI+H Sbjct: 48 YDRSIEILQDSTFVIYSIYH 67 >ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta reflexa] gi|156618874|ref|YP_001430155.1| hypothetical protein CureCp070 [Cuscuta reflexa] gi|401482|sp|P32035.1|YCX1_CUSRE RecName: Full=Uncharacterized 6.8 kDa protein in trnL 3'region; AltName: Full=ORF 55 [Cuscuta reflexa] gi|12523|emb|CAA47850.1| unnamed protein product [Cuscuta reflexa] gi|156556051|emb|CAM98434.1| hypothetical protein [Cuscuta reflexa] gi|156556059|emb|CAM98442.1| hypothetical protein [Cuscuta reflexa] gi|1096970|prf||2113216D ORF 55 Length = 55 Score = 67.0 bits (162), Expect = 5e-09 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = -1 Query: 344 LEYFY*SVMSYRPESDIQLLRFELSGGCLILYLYIISKRWTIKPISRFNR 195 +EY Y SVMSYR + DIQLLRFELSG CLI ISKRWTIKP+SRF + Sbjct: 7 VEYLYRSVMSYRTQLDIQLLRFELSGECLI----DISKRWTIKPLSRFTQ 52 >gb|KQJ96841.1| hypothetical protein BRADI_3g27343, partial [Brachypodium distachyon] gi|944082856|gb|KQK18208.1| hypothetical protein BRADI_1g05797, partial [Brachypodium distachyon] Length = 98 Score = 50.1 bits (118), Expect(2) = 3e-07 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = +1 Query: 160 YLGPYSPHLFGLLLNREIGLIVHLFDIIYKYKIRHPPDNSNRSNWMSDSGLYD 318 +L Y HLFGLLLNREIGL P DN+NRS MSDSGLYD Sbjct: 40 FLFGYHMHLFGLLLNREIGLC--------------PTDNANRSYLMSDSGLYD 78 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +3 Query: 318 HDRSIEIL*HSTFVIYSIH 374 +DRSIEIL STFVIYSI+ Sbjct: 77 YDRSIEILQDSTFVIYSIY 95 >gb|KQJ88603.1| hypothetical protein BRADI_4g19726, partial [Brachypodium distachyon] Length = 98 Score = 50.1 bits (118), Expect(2) = 3e-07 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = +1 Query: 160 YLGPYSPHLFGLLLNREIGLIVHLFDIIYKYKIRHPPDNSNRSNWMSDSGLYD 318 +L Y HLFGLLLNREIGL P DN+NRS MSDSGLYD Sbjct: 40 FLFGYHMHLFGLLLNREIGLC--------------PTDNANRSYLMSDSGLYD 78 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +3 Query: 318 HDRSIEIL*HSTFVIYSIH 374 +DRSIEIL STFVIYSI+ Sbjct: 77 YDRSIEILQDSTFVIYSIY 95 >ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia oleracea] gi|11497597|ref|NP_055003.1| hypothetical protein SpolCp101 [Spinacia oleracea] gi|7636149|emb|CAB88771.1| hypothetical protein (chloroplast) [Spinacia oleracea] gi|7636178|emb|CAB88800.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 57 Score = 60.5 bits (145), Expect = 5e-07 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = -1 Query: 317 SYRPESDIQLLRFELSGGCLILYLYIISKRWTIKPISRFNRSPKR 183 SYRP SDIQLLRF LSGG YL ISKRWTIK + RFNRS KR Sbjct: 17 SYRPGSDIQLLRFALSGG----YLIYISKRWTIKLLFRFNRSLKR 57 >gb|KQJ95761.1| hypothetical protein BRADI_3g18879, partial [Brachypodium distachyon] Length = 98 Score = 47.8 bits (112), Expect(2) = 9e-06 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = +1 Query: 160 YLGPYSPHLFGLLLNREIGLIVHLFDIIYKYKIRHPPDNSNRSNWMSDSGLY 315 +L Y HLFGLLLNREIGL P DN+NRS MSDSGLY Sbjct: 40 FLFGYHMHLFGLLLNREIGLC--------------PTDNANRSYLMSDSGLY 77 Score = 28.5 bits (62), Expect(2) = 9e-06 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +3 Query: 318 HDRSIEIL*HSTFVIYSIH 374 + RSIEIL STFVIYSI+ Sbjct: 77 YGRSIEILQDSTFVIYSIY 95