BLASTX nr result
ID: Ziziphus21_contig00038349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038349 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008233609.1| PREDICTED: uncharacterized protein LOC103332... 73 9e-11 ref|XP_007220066.1| hypothetical protein PRUPE_ppa025332mg [Prun... 70 8e-10 ref|XP_002532293.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 ref|XP_011027862.1| PREDICTED: uncharacterized protein LOC105128... 57 5e-06 ref|XP_002311163.2| hypothetical protein POPTR_0008s05450g [Popu... 57 5e-06 >ref|XP_008233609.1| PREDICTED: uncharacterized protein LOC103332636 [Prunus mume] Length = 324 Score = 72.8 bits (177), Expect = 9e-11 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -2 Query: 179 EKVFHRYENIHHHDKGNKAPAMSKFLKDEEDGPFITITVDKNKDMELNRHAHLQ-PQYHS 3 EK H+ + +KGNKAP +S+FLKDEEDG FITI VDKNK+ ELN H HLQ PQYHS Sbjct: 241 EKGVHKIDG-QVQEKGNKAPPISRFLKDEEDGSFITIIVDKNKERELNHH-HLQLPQYHS 298 >ref|XP_007220066.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica] gi|462416528|gb|EMJ21265.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica] Length = 321 Score = 69.7 bits (169), Expect = 8e-10 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -2 Query: 140 DKGNKAPAMSKFLKDEEDGPFITITVDKNKDMELNRHAHLQ-PQYHS 3 +KGNKAP +S+FLKDEEDG FITI VDKNK+ EL H HLQ PQYHS Sbjct: 250 EKGNKAPPISRFLKDEEDGSFITIIVDKNKERELTHH-HLQLPQYHS 295 >ref|XP_002532293.1| conserved hypothetical protein [Ricinus communis] gi|223527995|gb|EEF30077.1| conserved hypothetical protein [Ricinus communis] Length = 322 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 143 HDKGNKAPAMSKFLKDEEDGPFITITVDKNKDMELNRHAHLQPQYHS 3 HD GNK P SKF+KDE+DGPFITI VD+NK+ ELN H PQ+HS Sbjct: 245 HDYGNK-PTSSKFIKDEDDGPFITIIVDRNKERELNHQNHQHPQFHS 290 >ref|XP_011027862.1| PREDICTED: uncharacterized protein LOC105128025 [Populus euphratica] Length = 316 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/71 (43%), Positives = 38/71 (53%), Gaps = 10/71 (14%) Frame = -2 Query: 185 ADEKVFHRY------ENIHHHD----KGNKAPAMSKFLKDEEDGPFITITVDKNKDMELN 36 ADEK++ R E + HD K PA S KDE+DGPF TI +D+NK+ ELN Sbjct: 220 ADEKLYRRKLMQEAGEKVQRHDVFAQDHTKMPASSNSNKDEDDGPFFTIIIDRNKERELN 279 Query: 35 RHAHLQPQYHS 3 H P Y S Sbjct: 280 EQNHQLPDYQS 290 >ref|XP_002311163.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa] gi|550332481|gb|EEE88530.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa] Length = 316 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/71 (45%), Positives = 38/71 (53%), Gaps = 10/71 (14%) Frame = -2 Query: 185 ADEKVFHRY------ENIHHHD----KGNKAPAMSKFLKDEEDGPFITITVDKNKDMELN 36 ADEK+ R E + HD K PA S KDE+DGPFITI +D+NK+ ELN Sbjct: 220 ADEKLHRRKLMQEAGEKVQRHDVFAQDHTKIPASSNSHKDEDDGPFITIIIDRNKERELN 279 Query: 35 RHAHLQPQYHS 3 H P Y S Sbjct: 280 EQNHQLPDYQS 290