BLASTX nr result
ID: Ziziphus21_contig00038254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038254 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP40526.1| hypothetical protein JCGZ_24525 [Jatropha curcas] 152 1e-34 ref|XP_002513063.1| Two-component response regulator ARR8, putat... 149 8e-34 ref|XP_003627814.1| two-component response regulator ARR3-like p... 146 5e-33 ref|XP_003545839.1| PREDICTED: two-component response regulator ... 145 1e-32 ref|XP_007011051.1| Two-component response regulator ARR8 [Theob... 144 2e-32 gb|AFK41171.1| unknown [Lotus japonicus] 144 3e-32 ref|XP_003541594.1| PREDICTED: two-component response regulator ... 144 3e-32 ref|XP_014522822.1| PREDICTED: two-component response regulator ... 143 6e-32 gb|KHN37666.1| Two-component response regulator ARR8 [Glycine soja] 143 6e-32 gb|KOM49219.1| hypothetical protein LR48_Vigan08g004600 [Vigna a... 142 1e-31 ref|XP_008245632.1| PREDICTED: two-component response regulator ... 142 1e-31 ref|XP_008231573.1| PREDICTED: two-component response regulator ... 142 1e-31 emb|CBX43986.1| putative A-type response regulator 4 [Populus x ... 142 1e-31 ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Popu... 142 1e-31 ref|XP_007133766.1| hypothetical protein PHAVU_011G207200g [Phas... 141 2e-31 ref|XP_004308594.1| PREDICTED: two-component response regulator ... 141 2e-31 ref|XP_004511028.1| PREDICTED: two-component response regulator ... 140 3e-31 ref|XP_011020390.1| PREDICTED: two-component response regulator ... 140 4e-31 gb|KDO49056.1| hypothetical protein CISIN_1g046192mg [Citrus sin... 140 5e-31 ref|XP_006470938.1| PREDICTED: two-component response regulator ... 140 5e-31 >gb|KDP40526.1| hypothetical protein JCGZ_24525 [Jatropha curcas] Length = 185 Score = 152 bits (383), Expect = 1e-34 Identities = 74/85 (87%), Positives = 81/85 (95%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL+DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 81 DYCMPGMTGYDLLRKIKESKSLKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 140 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KLKPHLMK KAKE +P+ NKRKGM Sbjct: 141 NKLKPHLMKGKAKEDEPS-NKRKGM 164 >ref|XP_002513063.1| Two-component response regulator ARR8, putative [Ricinus communis] gi|223548074|gb|EEF49566.1| Two-component response regulator ARR8, putative [Ricinus communis] Length = 197 Score = 149 bits (376), Expect = 8e-34 Identities = 71/85 (83%), Positives = 79/85 (92%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKS +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 89 DYCMPGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 148 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KLKPH+MK K +E +PN NKRKGM Sbjct: 149 NKLKPHMMKGKTRENEPN-NKRKGM 172 >ref|XP_003627814.1| two-component response regulator ARR3-like protein [Medicago truncatula] gi|92885116|gb|ABE87636.1| Response regulator receiver [Medicago truncatula] gi|355521836|gb|AET02290.1| two-component response regulator ARR3-like protein [Medicago truncatula] gi|388516389|gb|AFK46256.1| unknown [Medicago truncatula] Length = 177 Score = 146 bits (369), Expect = 5e-33 Identities = 71/85 (83%), Positives = 76/85 (89%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKS +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 78 DYCMPGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 137 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 SKLKPHL+KSK KE KRKGM Sbjct: 138 SKLKPHLLKSKVKEENEQPIKRKGM 162 >ref|XP_003545839.1| PREDICTED: two-component response regulator ARR8-like [Glycine max] gi|734391719|gb|KHN27335.1| Two-component response regulator ARR8 [Glycine soja] gi|947064130|gb|KRH13391.1| hypothetical protein GLYMA_15G236200 [Glycine max] Length = 179 Score = 145 bits (365), Expect = 1e-32 Identities = 73/87 (83%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 78 DYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADV 137 Query: 75 SKLKPHLMKSKAKEY--QPNINKRKGM 1 +KLKPHLMKS+AKE QP NKRK M Sbjct: 138 NKLKPHLMKSRAKEEQDQPFNNKRKDM 164 >ref|XP_007011051.1| Two-component response regulator ARR8 [Theobroma cacao] gi|508727964|gb|EOY19861.1| Two-component response regulator ARR8 [Theobroma cacao] Length = 188 Score = 144 bits (364), Expect = 2e-32 Identities = 66/85 (77%), Positives = 78/85 (91%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLR+IK S S +DIPVVIMSSEN+PSRINRCLE+GA+EFFLKPVQ+ DV Sbjct: 85 DYCMPGMTGYDLLRRIKGSSSFKDIPVVIMSSENIPSRINRCLEDGAEEFFLKPVQLSDV 144 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PHLMK ++KE Q NI+KRKGM Sbjct: 145 NKLRPHLMKGRSKEMQQNISKRKGM 169 >gb|AFK41171.1| unknown [Lotus japonicus] Length = 174 Score = 144 bits (362), Expect = 3e-32 Identities = 72/86 (83%), Positives = 77/86 (89%), Gaps = 3/86 (3%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL+DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 72 DYCMPGMTGYDLLRKIKESKSLKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 131 Query: 75 SKLKPHLMKSKAKE---YQPNINKRK 7 KLKPHLMKS+ KE QP NKRK Sbjct: 132 HKLKPHLMKSRVKEEQDRQPINNKRK 157 >ref|XP_003541594.1| PREDICTED: two-component response regulator ARR8-like [Glycine max] gi|947071846|gb|KRH20737.1| hypothetical protein GLYMA_13G197600 [Glycine max] Length = 179 Score = 144 bits (362), Expect = 3e-32 Identities = 72/87 (82%), Positives = 79/87 (90%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPG++GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 78 DYCMPGLTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADV 137 Query: 75 SKLKPHLMKSKAKEY--QPNINKRKGM 1 +KLKPHLMKS+AKE QP NKRK M Sbjct: 138 NKLKPHLMKSRAKEEQDQPFNNKRKDM 164 >ref|XP_014522822.1| PREDICTED: two-component response regulator ARR8 [Vigna radiata var. radiata] Length = 179 Score = 143 bits (360), Expect = 6e-32 Identities = 72/87 (82%), Positives = 78/87 (89%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 78 DYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADV 137 Query: 75 SKLKPHLMKSKAKE--YQPNINKRKGM 1 +KLKPHLMKS+ KE QP NKRK M Sbjct: 138 NKLKPHLMKSRTKEENEQPLNNKRKEM 164 >gb|KHN37666.1| Two-component response regulator ARR8 [Glycine soja] Length = 179 Score = 143 bits (360), Expect = 6e-32 Identities = 72/87 (82%), Positives = 78/87 (89%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 78 DYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADV 137 Query: 75 SKLKPHLMKSKAKEY--QPNINKRKGM 1 +KLKPHLMKS+ KE QP NKRK M Sbjct: 138 NKLKPHLMKSRPKEEQDQPFNNKRKDM 164 >gb|KOM49219.1| hypothetical protein LR48_Vigan08g004600 [Vigna angularis] Length = 161 Score = 142 bits (358), Expect = 1e-31 Identities = 71/87 (81%), Positives = 78/87 (89%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCL+EGA+EFFLKPVQ DV Sbjct: 60 DYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLDEGAEEFFLKPVQQADV 119 Query: 75 SKLKPHLMKSKAKE--YQPNINKRKGM 1 +KLKPHLMKS+ KE QP NKRK M Sbjct: 120 NKLKPHLMKSRTKEENEQPLNNKRKDM 146 >ref|XP_008245632.1| PREDICTED: two-component response regulator ARR9-like [Prunus mume] Length = 185 Score = 142 bits (358), Expect = 1e-31 Identities = 68/85 (80%), Positives = 76/85 (89%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKES L+DIPVVIMSSEN PSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 81 DYCMPGMTGYDLLRKIKESHVLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDV 140 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PH++K KA E Q NINKRK M Sbjct: 141 NKLRPHMLKGKAMEDQSNINKRKVM 165 >ref|XP_008231573.1| PREDICTED: two-component response regulator ARR9-like [Prunus mume] Length = 185 Score = 142 bits (358), Expect = 1e-31 Identities = 68/85 (80%), Positives = 76/85 (89%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKES L+DIPVVIMSSEN PSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 81 DYCMPGMTGYDLLRKIKESHVLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDV 140 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KLKPH++K +A E Q NINKRK M Sbjct: 141 NKLKPHMLKGRAMEDQSNINKRKVM 165 >emb|CBX43986.1| putative A-type response regulator 4 [Populus x canadensis] Length = 193 Score = 142 bits (358), Expect = 1e-31 Identities = 67/85 (78%), Positives = 75/85 (88%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLL+KIKESK +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 85 DYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 144 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PHLMK + KE NKRKGM Sbjct: 145 NKLRPHLMKGRCKEEDQPSNKRKGM 169 >ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa] gi|550343560|gb|EEE79774.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa] Length = 193 Score = 142 bits (357), Expect = 1e-31 Identities = 67/85 (78%), Positives = 75/85 (88%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLL+KIKESK +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 85 DYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 144 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PHLMK + KE NKRKGM Sbjct: 145 NKLRPHLMKGRCKEEDQPNNKRKGM 169 >ref|XP_007133766.1| hypothetical protein PHAVU_011G207200g [Phaseolus vulgaris] gi|561006766|gb|ESW05760.1| hypothetical protein PHAVU_011G207200g [Phaseolus vulgaris] Length = 230 Score = 141 bits (356), Expect = 2e-31 Identities = 73/88 (82%), Positives = 79/88 (89%), Gaps = 3/88 (3%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL++IPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 128 DYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADV 187 Query: 75 SKLKPHLMKSKAKE--YQPNI-NKRKGM 1 +KLKPHLMKS+ KE QP I NKRK M Sbjct: 188 NKLKPHLMKSRTKEEQEQPLINNKRKDM 215 >ref|XP_004308594.1| PREDICTED: two-component response regulator ARR9-like [Fragaria vesca subsp. vesca] Length = 187 Score = 141 bits (355), Expect = 2e-31 Identities = 66/85 (77%), Positives = 77/85 (90%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKSL+DIPVVIMSSEN PSRINRCLEEGA+EFFLKPV++ DV Sbjct: 83 DYCMPGMTGYDLLRKIKESKSLKDIPVVIMSSENEPSRINRCLEEGAEEFFLKPVKLSDV 142 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PH+MK + E + NI+KRK M Sbjct: 143 NKLRPHMMKGTSMEDEANISKRKAM 167 >ref|XP_004511028.1| PREDICTED: two-component response regulator ARR9-like [Cicer arietinum] Length = 179 Score = 140 bits (354), Expect = 3e-31 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 2/87 (2%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKESKS +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ DV Sbjct: 78 DYCMPGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQSDV 137 Query: 75 SKLKPHLMKSKAKEYQPNI--NKRKGM 1 +KLKPHL+KS+ KE + NKRK M Sbjct: 138 NKLKPHLLKSRVKEEEEQSINNKRKSM 164 >ref|XP_011020390.1| PREDICTED: two-component response regulator ARR8-like [Populus euphratica] Length = 193 Score = 140 bits (353), Expect = 4e-31 Identities = 66/85 (77%), Positives = 75/85 (88%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLL+KIKESK +DIPVVIMSSENVPSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 85 DYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDV 144 Query: 75 SKLKPHLMKSKAKEYQPNINKRKGM 1 +KL+PHLMK + KE NKRKG+ Sbjct: 145 NKLRPHLMKGRCKEEDQPNNKRKGI 169 >gb|KDO49056.1| hypothetical protein CISIN_1g046192mg [Citrus sinensis] Length = 187 Score = 140 bits (352), Expect = 5e-31 Identities = 70/88 (79%), Positives = 79/88 (89%), Gaps = 3/88 (3%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKES SL+DIPVVIMSSEN+PSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 70 DYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLKPVQLADV 129 Query: 75 SKLKPHLMKSKAKEY-QPN--INKRKGM 1 +KLKPHLMK +KE +PN NKRKG+ Sbjct: 130 NKLKPHLMKGISKEIKEPNNINNKRKGL 157 >ref|XP_006470938.1| PREDICTED: two-component response regulator ARR9-like [Citrus sinensis] Length = 187 Score = 140 bits (352), Expect = 5e-31 Identities = 70/88 (79%), Positives = 79/88 (89%), Gaps = 3/88 (3%) Frame = -2 Query: 255 DYCMPGMSGYDLLRKIKESKSLRDIPVVIMSSENVPSRINRCLEEGADEFFLKPVQMEDV 76 DYCMPGM+GYDLLRKIKES SL+DIPVVIMSSEN+PSRINRCLEEGA+EFFLKPVQ+ DV Sbjct: 70 DYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLEEGAEEFFLKPVQLADV 129 Query: 75 SKLKPHLMKSKAKEY-QPN--INKRKGM 1 +KLKPHLMK +KE +PN NKRKG+ Sbjct: 130 NKLKPHLMKGISKEINEPNNINNKRKGL 157