BLASTX nr result
ID: Ziziphus21_contig00038086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038086 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012091214.1| PREDICTED: probable disease resistance prote... 62 2e-07 ref|XP_002524222.1| Disease resistance protein RPP8, putative [R... 57 7e-06 >ref|XP_012091214.1| PREDICTED: probable disease resistance protein At1g58602 [Jatropha curcas] gi|643739066|gb|KDP44880.1| hypothetical protein JCGZ_01380 [Jatropha curcas] Length = 914 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +2 Query: 5 DIETLKDIPSSVLFRYDALNKLINIRNIGIDFEGSSNDDVRKVLASPIIQSGRLQSLNMY 184 ++ETLK I + L R DA++KL NIRNIGI+FE D+ +L S I SGRL+SL M Sbjct: 674 ELETLKWIKAKNLIRRDAMSKLNNIRNIGIEFEKIEEADL--ILNSLIFASGRLRSLKML 731 Query: 185 ISSGDGFPSLE 217 + G FPSLE Sbjct: 732 MLPGGLFPSLE 742 >ref|XP_002524222.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223536499|gb|EEF38146.1| Disease resistance protein RPP8, putative [Ricinus communis] Length = 942 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/68 (41%), Positives = 46/68 (67%) Frame = +2 Query: 2 KDIETLKDIPSSVLFRYDALNKLINIRNIGIDFEGSSNDDVRKVLASPIIQSGRLQSLNM 181 +++ETLK + + L R DA+ KL N+R++ I+F+ + ++ VL SPI++ GRL+SL M Sbjct: 692 RNLETLKWVKAKNLIRNDAMLKLTNLRDLAIEFQ--TTEEAEVVLKSPIVELGRLRSLKM 749 Query: 182 YISSGDGF 205 +I G F Sbjct: 750 FIELGSSF 757