BLASTX nr result
ID: Ziziphus21_contig00038001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00038001 (451 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007587816.1| hypothetical protein UCRNP2_8577 [Neofusicoc... 71 3e-10 gb|EKG21107.1| hypothetical protein MPH_01560, partial [Macropho... 66 9e-09 >ref|XP_007587816.1| hypothetical protein UCRNP2_8577 [Neofusicoccum parvum UCRNP2] gi|485917928|gb|EOD44713.1| hypothetical protein UCRNP2_8577 [Neofusicoccum parvum UCRNP2] Length = 231 Score = 71.2 bits (173), Expect = 3e-10 Identities = 43/100 (43%), Positives = 49/100 (49%), Gaps = 8/100 (8%) Frame = +1 Query: 175 MASPKTMEPPTDLEKGELRPLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- 351 M SP+ MEP +DLEKGELRPLL Sbjct: 1 MTSPRDMEP-SDLEKGELRPLLAPTDAASGTGDADDGATGSLAAAADAANEASTSSLLTT 59 Query: 352 -------FCSALLISLYRHPVWLQHLLDLSRMPCSHRSEE 450 CSALLISLYRHP+WLQHLLDLSRMPC+H + + Sbjct: 60 ITTSTATLCSALLISLYRHPLWLQHLLDLSRMPCNHPNHQ 99 >gb|EKG21107.1| hypothetical protein MPH_01560, partial [Macrophomina phaseolina MS6] Length = 186 Score = 66.2 bits (160), Expect = 9e-09 Identities = 36/67 (53%), Positives = 39/67 (58%) Frame = +1 Query: 1 ANNAQPEXXXXXXXXXXXCRFRKAIKVLGIESYPEFATAKPYQAXXXXXXXXXXXXXXMA 180 A NAQP+ RFRKAIKVLGIESYPEFATAKP+QA M Sbjct: 120 AINAQPDYSYRPYSYLYYYRFRKAIKVLGIESYPEFATAKPHQAKPAARSSRPAPHPKMT 179 Query: 181 SPKTMEP 201 SP+TMEP Sbjct: 180 SPRTMEP 186