BLASTX nr result
ID: Ziziphus21_contig00037820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037820 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588321.1| hypothetical protein ZeamMp058 (mitochondrion) ... 48 2e-08 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 49 5e-08 >ref|YP_588321.1| hypothetical protein ZeamMp058 (mitochondrion) [Zea mays subsp. mays] gi|40795110|gb|AAR91154.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954039|gb|AFW86688.1| putative uncharacterized protein orf109-a [Zea mays] gi|413954253|gb|AFW86902.1| putative uncharacterized protein orf109-a [Zea mays] gi|414888179|tpg|DAA64193.1| TPA: putative uncharacterized protein orf109-a [Zea mays] Length = 109 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +1 Query: 244 PKWAYGRSNWYLIGRFGFVQRPRSRKRQLSFERKRP 351 P+ A+ RSN YLIGRF FVQ PR R+LSF KRP Sbjct: 17 PRRAHQRSNCYLIGRFAFVQGPRCWNRRLSFSSKRP 52 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 191 MSITHRRLVRTEGQCPP 241 MSITH RLVRTEGQCPP Sbjct: 1 MSITHLRLVRTEGQCPP 17 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = +2 Query: 47 LRWSS--LIFPNVQSCSGLRKEHRPSALNE 130 +RWSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 35.4 bits (80), Expect(2) = 5e-08 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 1 PLSFGSNKSSAFGRFAQV 54 PLSFGS+KSS FGRFAQV Sbjct: 17 PLSFGSDKSSPFGRFAQV 34