BLASTX nr result
ID: Ziziphus21_contig00037799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037799 (271 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012067119.1| PREDICTED: probable polyamine transporter At... 60 5e-07 ref|XP_012067120.1| PREDICTED: probable polyamine transporter At... 60 5e-07 ref|XP_002527073.1| amino acid transporter, putative [Ricinus co... 59 2e-06 ref|XP_010552261.1| PREDICTED: probable polyamine transporter At... 58 2e-06 ref|XP_002299117.1| amino acid permease family protein [Populus ... 58 2e-06 >ref|XP_012067119.1| PREDICTED: probable polyamine transporter At3g13620 isoform X1 [Jatropha curcas] Length = 483 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 269 SKEVYLVSGLMTAGAILWYFFMNFCRSKNLFKFSKDHQIE 150 +K VYLVSGLMT GAI WYF M FCRSK LFK+S IE Sbjct: 444 TKVVYLVSGLMTVGAIGWYFIMKFCRSKKLFKYSNGENIE 483 >ref|XP_012067120.1| PREDICTED: probable polyamine transporter At3g13620 isoform X2 [Jatropha curcas] gi|643735556|gb|KDP42129.1| hypothetical protein JCGZ_01917 [Jatropha curcas] Length = 429 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 269 SKEVYLVSGLMTAGAILWYFFMNFCRSKNLFKFSKDHQIE 150 +K VYLVSGLMT GAI WYF M FCRSK LFK+S IE Sbjct: 390 TKVVYLVSGLMTVGAIGWYFIMKFCRSKKLFKYSNGENIE 429 >ref|XP_002527073.1| amino acid transporter, putative [Ricinus communis] gi|223533578|gb|EEF35317.1| amino acid transporter, putative [Ricinus communis] Length = 465 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 269 SKEVYLVSGLMTAGAILWYFFMNFCRSKNLFKFSKDHQIE 150 +K VYLVSGLMT GAI WYF M FC+SK LFK+S+ I+ Sbjct: 425 TKTVYLVSGLMTVGAIGWYFLMKFCKSKKLFKYSRTEVID 464 >ref|XP_010552261.1| PREDICTED: probable polyamine transporter At3g13620 [Tarenaya hassleriana] Length = 469 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 269 SKEVYLVSGLMTAGAILWYFFMNFCRSKNLFKFS 168 +K VYL+SGLMTAGAI WYF MNFCRS+ +F+FS Sbjct: 426 TKTVYLLSGLMTAGAIGWYFLMNFCRSRKIFEFS 459 >ref|XP_002299117.1| amino acid permease family protein [Populus trichocarpa] gi|222846375|gb|EEE83922.1| amino acid permease family protein [Populus trichocarpa] Length = 471 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 269 SKEVYLVSGLMTAGAILWYFFMNFCRSKNLFKFSKDHQIEE 147 +K VYLVSGLMT GAI +YFFMNFC++K FKFS IE+ Sbjct: 431 TKTVYLVSGLMTVGAIGFYFFMNFCKTKQWFKFSSGEVIED 471