BLASTX nr result
ID: Ziziphus21_contig00037588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037588 (261 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012467441.1| PREDICTED: probable E3 ubiquitin-protein lig... 101 2e-19 ref|XP_008221903.1| PREDICTED: RING-H2 finger protein ATL47 [Pru... 100 3e-19 ref|XP_007223707.1| hypothetical protein PRUPE_ppa013029mg [Prun... 100 3e-19 ref|XP_002530038.1| protein binding protein, putative [Ricinus c... 99 2e-18 ref|XP_010100412.1| E3 ubiquitin-protein ligase RHA2A [Morus not... 98 2e-18 ref|XP_007044820.1| RING/U-box superfamily protein [Theobroma ca... 98 2e-18 ref|XP_002311762.1| zinc finger family protein [Populus trichoca... 98 3e-18 ref|XP_002314594.1| zinc finger family protein [Populus trichoca... 97 4e-18 ref|XP_011042399.1| PREDICTED: probable E3 ubiquitin-protein lig... 96 1e-17 ref|XP_011034058.1| PREDICTED: probable E3 ubiquitin-protein lig... 96 1e-17 ref|XP_012085531.1| PREDICTED: probable E3 ubiquitin-protein lig... 96 1e-17 ref|XP_008245200.1| PREDICTED: E3 ubiquitin-protein ligase RNF18... 95 2e-17 ref|XP_004299221.1| PREDICTED: probable E3 ubiquitin-protein lig... 94 3e-17 ref|XP_008350938.1| PREDICTED: E3 ubiquitin-protein ligase At1g1... 94 4e-17 ref|XP_011086652.1| PREDICTED: probable E3 ubiquitin-protein lig... 94 5e-17 ref|XP_010650490.1| PREDICTED: probable E3 ubiquitin-protein lig... 94 5e-17 emb|CBI16789.3| unnamed protein product [Vitis vinifera] 94 5e-17 ref|XP_011655602.1| PREDICTED: probable E3 ubiquitin-protein lig... 93 7e-17 ref|XP_008340097.1| PREDICTED: E3 ubiquitin-protein ligase RNF18... 93 9e-17 ref|XP_007163682.1| hypothetical protein PHAVU_001G255200g [Phas... 92 1e-16 >ref|XP_012467441.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] gi|763748201|gb|KJB15640.1| hypothetical protein B456_002G187900 [Gossypium raimondii] Length = 159 Score = 101 bits (252), Expect = 2e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLCGFEADEEVSELSCKHFFHKGCLEKWF NK +TCPLCRS Sbjct: 112 VECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFGNKHSTCPLCRS 157 >ref|XP_008221903.1| PREDICTED: RING-H2 finger protein ATL47 [Prunus mume] Length = 145 Score = 100 bits (250), Expect = 3e-19 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 MECCVCLCGFEA++EVSELSCKHFFHKGCLEKWF N +TCPLCRS D Sbjct: 98 MECCVCLCGFEAEQEVSELSCKHFFHKGCLEKWFDNNHSTCPLCRSVD 145 >ref|XP_007223707.1| hypothetical protein PRUPE_ppa013029mg [Prunus persica] gi|462420643|gb|EMJ24906.1| hypothetical protein PRUPE_ppa013029mg [Prunus persica] Length = 143 Score = 100 bits (250), Expect = 3e-19 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 MECCVCLCGFEA++EVSELSCKHFFHKGCLEKWF N +TCPLCRS D Sbjct: 96 MECCVCLCGFEAEQEVSELSCKHFFHKGCLEKWFDNNHSTCPLCRSVD 143 >ref|XP_002530038.1| protein binding protein, putative [Ricinus communis] gi|223530454|gb|EEF32338.1| protein binding protein, putative [Ricinus communis] Length = 139 Score = 98.6 bits (244), Expect = 2e-18 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLCGFE DEEVSELSCKHFFHKGCL+KWF NK +TCPLCRS Sbjct: 92 VECCVCLCGFEEDEEVSELSCKHFFHKGCLDKWFDNKHSTCPLCRS 137 >ref|XP_010100412.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis] gi|587894014|gb|EXB82546.1| E3 ubiquitin-protein ligase RHA2A [Morus notabilis] Length = 167 Score = 98.2 bits (243), Expect = 2e-18 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -1 Query: 219 ECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 ECCVC CGFEADEEVSELSCKHFFHK CL+KWF NK TCPLCRS D Sbjct: 121 ECCVCFCGFEADEEVSELSCKHFFHKNCLDKWFHNKHTTCPLCRSID 167 >ref|XP_007044820.1| RING/U-box superfamily protein [Theobroma cacao] gi|508708755|gb|EOY00652.1| RING/U-box superfamily protein [Theobroma cacao] Length = 138 Score = 98.2 bits (243), Expect = 2e-18 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLCGFEADEEVSELSCKHFFHK CLEKWF NK +TCPLCRS Sbjct: 91 VECCVCLCGFEADEEVSELSCKHFFHKVCLEKWFDNKHSTCPLCRS 136 >ref|XP_002311762.1| zinc finger family protein [Populus trichocarpa] gi|222851582|gb|EEE89129.1| zinc finger family protein [Populus trichocarpa] Length = 139 Score = 97.8 bits (242), Expect = 3e-18 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 MECCVCLCGF+A+EEVSEL CKHFFH+GCL+KWF NK+ATCPLCRS Sbjct: 88 MECCVCLCGFQAEEEVSELHCKHFFHRGCLDKWFDNKQATCPLCRS 133 >ref|XP_002314594.1| zinc finger family protein [Populus trichocarpa] gi|222863634|gb|EEF00765.1| zinc finger family protein [Populus trichocarpa] Length = 133 Score = 97.4 bits (241), Expect = 4e-18 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 MECCVCLCGFEA+EEVSELSCKHFFH+GCL+KWF N ATCPLCRS Sbjct: 86 MECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWFDNIHATCPLCRS 131 >ref|XP_011042399.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus euphratica] Length = 134 Score = 95.9 bits (237), Expect = 1e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 MECCVCLCGFEA+EEVSELSCKHFFH+GCL+KWF N TCPLCRS Sbjct: 87 MECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWFDNIHTTCPLCRS 132 >ref|XP_011034058.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus euphratica] Length = 138 Score = 95.5 bits (236), Expect = 1e-17 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 MECCVCLCGF+A+EEVSEL CKHFFH+ CL+KWF NK+ATCPLCRS Sbjct: 87 MECCVCLCGFQAEEEVSELHCKHFFHRACLDKWFDNKQATCPLCRS 132 >ref|XP_012085531.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Jatropha curcas] gi|643714026|gb|KDP26691.1| hypothetical protein JCGZ_17849 [Jatropha curcas] Length = 139 Score = 95.5 bits (236), Expect = 1e-17 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLCGFEA+EEVSELSCKHFFH+GCL+KW NK +TCPLCRS Sbjct: 92 VECCVCLCGFEAEEEVSELSCKHFFHRGCLDKWIDNKHSTCPLCRS 137 >ref|XP_008245200.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Prunus mume] Length = 117 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 MECCVCLCGFEA +EVSELSCKHFFHKGCLEKWF N + CPLCR D Sbjct: 70 MECCVCLCGFEAKQEVSELSCKHFFHKGCLEKWFDNNHSICPLCRFVD 117 >ref|XP_004299221.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Fragaria vesca subsp. vesca] Length = 138 Score = 94.4 bits (233), Expect = 3e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLCGFE ++EVSELSCKHFFHKGCLEKWF N TCPLCRS Sbjct: 91 VECCVCLCGFEEEQEVSELSCKHFFHKGCLEKWFDNDHTTCPLCRS 136 >ref|XP_008350938.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Malus domestica] Length = 128 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/48 (83%), Positives = 43/48 (89%), Gaps = 1/48 (2%) Frame = -1 Query: 219 ECCVCLCGFEADEEVSELSCKHFFHKGCLEKWF-LNKRATCPLCRSTD 79 +CCVCLCGFEA++EVSELSCKHFFHKGCLEKWF N R TCPLCRS D Sbjct: 81 QCCVCLCGFEAEQEVSELSCKHFFHKGCLEKWFDHNHRTTCPLCRSFD 128 >ref|XP_011086652.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Sesamum indicum] Length = 161 Score = 93.6 bits (231), Expect = 5e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 +ECCVCLC FEA+EEVSELSCKHFFHKGCL+KWF N+ TCPLCRS Sbjct: 114 VECCVCLCRFEAEEEVSELSCKHFFHKGCLDKWFDNQHITCPLCRS 159 >ref|XP_010650490.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Vitis vinifera] Length = 162 Score = 93.6 bits (231), Expect = 5e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 M+CCVCLC FEA+EEVSELSCKHFFHKGC EKWF NK ++CPLCRS Sbjct: 115 MDCCVCLCRFEAEEEVSELSCKHFFHKGCWEKWFDNKHSSCPLCRS 160 >emb|CBI16789.3| unnamed protein product [Vitis vinifera] Length = 138 Score = 93.6 bits (231), Expect = 5e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRS 85 M+CCVCLC FEA+EEVSELSCKHFFHKGC EKWF NK ++CPLCRS Sbjct: 91 MDCCVCLCRFEAEEEVSELSCKHFFHKGCWEKWFDNKHSSCPLCRS 136 >ref|XP_011655602.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Cucumis sativus] gi|700196570|gb|KGN51747.1| hypothetical protein Csa_5G598060 [Cucumis sativus] Length = 138 Score = 93.2 bits (230), Expect = 7e-17 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = -1 Query: 219 ECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 ECCVCLC FEADEEVSELSCKHFFHK CL KWF NK TCPLCRS + Sbjct: 92 ECCVCLCRFEADEEVSELSCKHFFHKACLSKWFDNKHFTCPLCRSIE 138 >ref|XP_008340097.1| PREDICTED: E3 ubiquitin-protein ligase RNF181 [Malus domestica] Length = 128 Score = 92.8 bits (229), Expect = 9e-17 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 219 ECCVCLCGFEADEEVSELSCKHFFHKGCLEKWF-LNKRATCPLCRSTD 79 ECCVCLCGFEA+EEVSELSCKHFFHK CLEKWF N TCPLCRS D Sbjct: 81 ECCVCLCGFEAEEEVSELSCKHFFHKSCLEKWFEHNNSTTCPLCRSVD 128 >ref|XP_007163682.1| hypothetical protein PHAVU_001G255200g [Phaseolus vulgaris] gi|561037146|gb|ESW35676.1| hypothetical protein PHAVU_001G255200g [Phaseolus vulgaris] Length = 125 Score = 92.4 bits (228), Expect = 1e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 222 MECCVCLCGFEADEEVSELSCKHFFHKGCLEKWFLNKRATCPLCRSTD 79 +ECCVCLC FE +EEVSEL CKH+FH+GCLEKWF NK TCPLCRS D Sbjct: 78 VECCVCLCRFEGNEEVSELPCKHYFHRGCLEKWFDNKHVTCPLCRSMD 125