BLASTX nr result
ID: Ziziphus21_contig00037546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037546 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112946.1| hypothetical protein L484_021467 [Morus nota... 60 8e-07 ref|XP_002278446.1| PREDICTED: uncharacterized protein LOC100241... 58 2e-06 >ref|XP_010112946.1| hypothetical protein L484_021467 [Morus notabilis] gi|587948878|gb|EXC35105.1| hypothetical protein L484_021467 [Morus notabilis] Length = 333 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -3 Query: 123 CQKNDGKGWQCKKEAKEGHNFCEHH 49 CQKNDGKGWQCK+EAKE +NFCEHH Sbjct: 142 CQKNDGKGWQCKREAKENYNFCEHH 166 >ref|XP_002278446.1| PREDICTED: uncharacterized protein LOC100241428 [Vitis vinifera] gi|297745355|emb|CBI40435.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 153 AAAMSKIIIHCQKNDGKGWQCKKEAKEGHNFCEHH 49 A+ +K I+ C K+DGKGWQC+K AKEGH CEHH Sbjct: 122 ASTKNKTILFCNKSDGKGWQCRKAAKEGHALCEHH 156