BLASTX nr result
ID: Ziziphus21_contig00037481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037481 (261 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN56172.1| hypothetical protein Csa_3G088940 [Cucumis sativus] 71 1e-15 ref|XP_007155859.1| hypothetical protein PHAVU_003G237800g [Phas... 73 2e-13 ref|XP_010086548.1| hypothetical protein L484_001090 [Morus nota... 63 8e-08 gb|KQK85843.1| hypothetical protein SETIT_020798mg [Setaria ital... 57 4e-06 >gb|KGN56172.1| hypothetical protein Csa_3G088940 [Cucumis sativus] Length = 215 Score = 71.2 bits (173), Expect(2) = 1e-15 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +3 Query: 156 LNCLSCAREGPPVPRQHLEVHLVVLHETRDIPHSM 260 LNCLSCAREGPPVPRQHLEVH VL ETRDIPHSM Sbjct: 149 LNCLSCAREGPPVPRQHLEVHFDVLDETRDIPHSM 183 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 10/44 (22%) Frame = +1 Query: 4 VEWECSMG-----KVSGRQRGRQTGLLSAAK-----PGESQVPE 105 +EWECS+ ++SG G TGLLSAAK GESQVPE Sbjct: 100 LEWECSVAHGARLELSGSLNGTPTGLLSAAKLICPRSGESQVPE 143 >ref|XP_007155859.1| hypothetical protein PHAVU_003G237800g [Phaseolus vulgaris] gi|561029213|gb|ESW27853.1| hypothetical protein PHAVU_003G237800g [Phaseolus vulgaris] Length = 68 Score = 73.2 bits (178), Expect(2) = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 261 PWSEEYPESHVRQLNAPRGAAEELGGLLEHRIGN 160 PWSEEYPESHVRQLNAPRGAAEELG LLEHRIGN Sbjct: 7 PWSEEYPESHVRQLNAPRGAAEELGDLLEHRIGN 40 Score = 28.9 bits (63), Expect(2) = 2e-13 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 161 IELAYSLWGINA 126 IELAYSLWGINA Sbjct: 43 IELAYSLWGINA 54 >ref|XP_010086548.1| hypothetical protein L484_001090 [Morus notabilis] gi|587829257|gb|EXB20186.1| hypothetical protein L484_001090 [Morus notabilis] Length = 51 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 261 PWSEEYPESHVRQLNAPRGAAEELGGLLEHRI 166 PWSEEYPESHVRQLNAPRGAAEELG LLE ++ Sbjct: 19 PWSEEYPESHVRQLNAPRGAAEELGDLLEQQL 50 >gb|KQK85843.1| hypothetical protein SETIT_020798mg [Setaria italica] Length = 40 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 261 PWSEEYPESHVRQLNAPRGAAEELGGLLEHRIGN 160 PWS EYP+S V QLNA +GAAEELG LLEHRIGN Sbjct: 7 PWSGEYPQSKVIQLNALQGAAEELGDLLEHRIGN 40