BLASTX nr result
ID: Ziziphus21_contig00037347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037347 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001700736.1| hypothetical protein CHLREDRAFT_187371 [Chla... 60 5e-07 ref|XP_002956213.1| hypothetical protein VOLCADRAFT_107104 [Volv... 59 1e-06 ref|XP_005844068.1| hypothetical protein CHLNCDRAFT_59045 [Chlor... 57 5e-06 >ref|XP_001700736.1| hypothetical protein CHLREDRAFT_187371 [Chlamydomonas reinhardtii] gi|158281235|gb|EDP06990.1| predicted protein [Chlamydomonas reinhardtii] Length = 178 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 315 ALRSLAGHYSNFGATTPVPKKRLERAQKELVDAEKFLTRDR 193 AL +LAGH+++FGAT P+PKKRLER QKEL DA LTR+R Sbjct: 138 ALNALAGHFNSFGATAPIPKKRLERLQKELDDATLLLTRNR 178 >ref|XP_002956213.1| hypothetical protein VOLCADRAFT_107104 [Volvox carteri f. nagariensis] gi|300258516|gb|EFJ42752.1| hypothetical protein VOLCADRAFT_107104 [Volvox carteri f. nagariensis] Length = 178 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -2 Query: 315 ALRSLAGHYSNFGATTPVPKKRLERAQKELVDAEKFLTRDR 193 AL +LAGH+++FGAT P+PKKRLER QKEL DA L R+R Sbjct: 138 ALNALAGHFNSFGATAPIPKKRLERLQKELDDASTLLNRNR 178 >ref|XP_005844068.1| hypothetical protein CHLNCDRAFT_59045 [Chlorella variabilis] gi|307103708|gb|EFN51966.1| hypothetical protein CHLNCDRAFT_59045 [Chlorella variabilis] Length = 176 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 315 ALRSLAGHYSNFGATTPVPKKRLERAQKELVDAEKFLTRDR 193 A+ ++AGH ++FGAT P+PKKRLER KEL DAE+FL R R Sbjct: 136 AVNAMAGHLNSFGATAPIPKKRLERLVKELDDAERFLGRGR 176