BLASTX nr result
ID: Ziziphus21_contig00037264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037264 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016969.1| O-Glycosyl hydrolases family 17 protein [The... 57 5e-06 >ref|XP_007016969.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao] gi|508787332|gb|EOY34588.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao] Length = 494 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 193 MPPNLRLXXXXXXXXXFVLASRARAIGVNWGTMASHXXXXXXXXXXXKSNDINKVKLFDA 14 +P NL L +L S A AIGVNWG M+SH KSN+++KVKLFDA Sbjct: 2 LPQNLFLILLLVLTFPCLLGSTAGAIGVNWGAMSSHPLPAPKVVELLKSNNVSKVKLFDA 61 Query: 13 DPLV 2 DPLV Sbjct: 62 DPLV 65