BLASTX nr result
ID: Ziziphus21_contig00037215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037215 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223980.1| hypothetical protein PRUPE_ppa014734mg [Prun... 88 3e-15 ref|XP_008223864.1| PREDICTED: uncharacterized protein LOC103323... 86 1e-14 ref|XP_004296504.2| PREDICTED: uncharacterized protein LOC101298... 84 4e-14 ref|XP_010094234.1| hypothetical protein L484_005565 [Morus nota... 80 6e-13 ref|XP_012084272.1| PREDICTED: uncharacterized protein LOC105643... 80 6e-13 ref|XP_009348623.1| PREDICTED: uncharacterized protein LOC103940... 80 8e-13 ref|XP_009359954.1| PREDICTED: uncharacterized protein LOC103950... 80 8e-13 ref|XP_008390433.1| PREDICTED: uncharacterized protein LOC103452... 80 8e-13 ref|XP_007138758.1| hypothetical protein PHAVU_009G234900g [Phas... 78 3e-12 ref|XP_003595096.1| hypothetical protein MTR_2g038220 [Medicago ... 77 4e-12 ref|XP_003546438.2| PREDICTED: uncharacterized protein LOC100817... 77 4e-12 ref|XP_004488013.1| PREDICTED: uncharacterized protein LOC101490... 77 4e-12 ref|XP_007014488.1| Uncharacterized protein TCM_039604 [Theobrom... 77 5e-12 ref|XP_012092640.1| PREDICTED: uncharacterized protein LOC105650... 77 7e-12 ref|XP_014500683.1| PREDICTED: uncharacterized protein LOC106761... 76 9e-12 gb|KOM39871.1| hypothetical protein LR48_Vigan04g006900 [Vigna a... 76 9e-12 gb|KRH37348.1| hypothetical protein GLYMA_09G060700 [Glycine max] 76 1e-11 ref|XP_010276698.1| PREDICTED: uncharacterized protein LOC104611... 76 1e-11 ref|XP_008391556.1| PREDICTED: uncharacterized protein LOC103453... 76 1e-11 ref|XP_006587000.1| PREDICTED: uncharacterized protein LOC100819... 76 1e-11 >ref|XP_007223980.1| hypothetical protein PRUPE_ppa014734mg [Prunus persica] gi|462420916|gb|EMJ25179.1| hypothetical protein PRUPE_ppa014734mg [Prunus persica] Length = 67 Score = 87.8 bits (216), Expect = 3e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE QWKFCFLP+CFKIKRKYFCTLCARRLVLYY Sbjct: 28 GKVQAVDVEAQWKFCFLPMCFKIKRKYFCTLCARRLVLYY 67 >ref|XP_008223864.1| PREDICTED: uncharacterized protein LOC103323638 [Prunus mume] Length = 67 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE QWK CFLP+CFKIKRKYFCTLCARRLVLYY Sbjct: 28 GKVQAVDVEAQWKLCFLPMCFKIKRKYFCTLCARRLVLYY 67 >ref|XP_004296504.2| PREDICTED: uncharacterized protein LOC101298504 [Fragaria vesca subsp. vesca] Length = 130 Score = 84.0 bits (206), Expect = 4e-14 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QWKFCFLP+CFKIKRKYFC+LC+RRLVLYY Sbjct: 91 GKVEAVDVEAQWKFCFLPMCFKIKRKYFCSLCSRRLVLYY 130 >ref|XP_010094234.1| hypothetical protein L484_005565 [Morus notabilis] gi|703162628|ref|XP_010113104.1| hypothetical protein L484_000082 [Morus notabilis] gi|587865920|gb|EXB55432.1| hypothetical protein L484_005565 [Morus notabilis] gi|587980470|gb|EXC65044.1| hypothetical protein L484_000082 [Morus notabilis] Length = 67 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVETQWKFCFLP+CFKIKRK FCTLC+RRLVL Y Sbjct: 28 GKVEAMDVETQWKFCFLPMCFKIKRKLFCTLCSRRLVLSY 67 >ref|XP_012084272.1| PREDICTED: uncharacterized protein LOC105643695 [Jatropha curcas] gi|643715955|gb|KDP27763.1| hypothetical protein JCGZ_19990 [Jatropha curcas] Length = 67 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVET+W FCFLP+C+KIKRKYFCTLCARRL LY+ Sbjct: 28 GKVQAMDVETKWSFCFLPICYKIKRKYFCTLCARRLELYH 67 >ref|XP_009348623.1| PREDICTED: uncharacterized protein LOC103940260 [Pyrus x bretschneideri] Length = 89 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE Q K CFLPLCFKIKRKYFCTLC+RRLVLYY Sbjct: 50 GKVQAVDVEAQRKLCFLPLCFKIKRKYFCTLCSRRLVLYY 89 >ref|XP_009359954.1| PREDICTED: uncharacterized protein LOC103950465 [Pyrus x bretschneideri] Length = 67 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE Q K CFLPLCFKIKRKYFCTLC+RRLVLYY Sbjct: 28 GKVQAVDVEAQRKLCFLPLCFKIKRKYFCTLCSRRLVLYY 67 >ref|XP_008390433.1| PREDICTED: uncharacterized protein LOC103452674 [Malus domestica] Length = 67 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE Q K CFLPLCFKIKRKYFCTLC+RRLVLYY Sbjct: 28 GKVQAVDVEAQRKLCFLPLCFKIKRKYFCTLCSRRLVLYY 67 >ref|XP_007138758.1| hypothetical protein PHAVU_009G234900g [Phaseolus vulgaris] gi|561011845|gb|ESW10752.1| hypothetical protein PHAVU_009G234900g [Phaseolus vulgaris] Length = 67 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QWKFCFLP+CFKIKRK+FCT CARRL LY+ Sbjct: 28 GKVEAMDVEIQWKFCFLPMCFKIKRKFFCTSCARRLELYF 67 >ref|XP_003595096.1| hypothetical protein MTR_2g038220 [Medicago truncatula] gi|87162672|gb|ABD28467.1| hypothetical protein MtrDRAFT_AC148819g4v2 [Medicago truncatula] gi|355484144|gb|AES65347.1| hypothetical protein MTR_2g038220 [Medicago truncatula] Length = 104 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QW+FCFLP+CFKIKRK+FCTLCARRL L Y Sbjct: 64 GKVEAMDVEMQWRFCFLPMCFKIKRKFFCTLCARRLELQY 103 >ref|XP_003546438.2| PREDICTED: uncharacterized protein LOC100817592 [Glycine max] gi|734385234|gb|KHN24636.1| hypothetical protein glysoja_032280 [Glycine soja] gi|947063086|gb|KRH12347.1| hypothetical protein GLYMA_15G167300 [Glycine max] Length = 117 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QW+ CFLP+CFKIKRKYFCT CARRL LYY Sbjct: 78 GKVEAMDVEIQWRLCFLPMCFKIKRKYFCTSCARRLELYY 117 >ref|XP_004488013.1| PREDICTED: uncharacterized protein LOC101490751 [Cicer arietinum] Length = 111 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QW+FCFLP+CFKIKRKYFCTLCARRL L + Sbjct: 71 GKVEAMDVEIQWRFCFLPMCFKIKRKYFCTLCARRLELQF 110 >ref|XP_007014488.1| Uncharacterized protein TCM_039604 [Theobroma cacao] gi|508784851|gb|EOY32107.1| Uncharacterized protein TCM_039604 [Theobroma cacao] Length = 67 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV A DVE++W+FCFLP+CFKIKRKY CTLC+RRLVLYY Sbjct: 28 GKVVAADVESRWRFCFLPICFKIKRKYSCTLCSRRLVLYY 67 >ref|XP_012092640.1| PREDICTED: uncharacterized protein LOC105650361 [Jatropha curcas] gi|643701092|gb|KDP20346.1| hypothetical protein JCGZ_06884 [Jatropha curcas] Length = 67 Score = 76.6 bits (187), Expect = 7e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVL 159 GKVQA+DVET+W FCFLP+C+KIKRKYFCTLCARRL L Sbjct: 28 GKVQAMDVETKWSFCFLPICYKIKRKYFCTLCARRLEL 65 >ref|XP_014500683.1| PREDICTED: uncharacterized protein LOC106761631 [Vigna radiata var. radiata] Length = 67 Score = 76.3 bits (186), Expect = 9e-12 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QWKFCFLP+CFKIKRK+FCT CARRL L++ Sbjct: 28 GKVEAMDVEIQWKFCFLPMCFKIKRKFFCTSCARRLELFF 67 >gb|KOM39871.1| hypothetical protein LR48_Vigan04g006900 [Vigna angularis] Length = 67 Score = 76.3 bits (186), Expect = 9e-12 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QWKFCFLP+CFKIKRK+FCT CARRL L++ Sbjct: 28 GKVEAMDVEIQWKFCFLPMCFKIKRKFFCTSCARRLELFF 67 >gb|KRH37348.1| hypothetical protein GLYMA_09G060700 [Glycine max] Length = 117 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QW+ CFLP+CFKIKRK+FCT CARRL LYY Sbjct: 78 GKVEAMDVEIQWRLCFLPMCFKIKRKFFCTSCARRLELYY 117 >ref|XP_010276698.1| PREDICTED: uncharacterized protein LOC104611379 [Nelumbo nucifera] Length = 67 Score = 75.9 bits (185), Expect = 1e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLY 156 G VQA+DVE+QW+FCFLP CF+ KRKYFCT+CARRLV+Y Sbjct: 28 GMVQAVDVESQWRFCFLPFCFRTKRKYFCTVCARRLVVY 66 >ref|XP_008391556.1| PREDICTED: uncharacterized protein LOC103453765 [Malus domestica] gi|694407325|ref|XP_009378409.1| PREDICTED: uncharacterized protein LOC103966908 [Pyrus x bretschneideri] Length = 67 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKVQA+DVE Q K CFLPLCFKIKRKYFCTLC+RRLVL Y Sbjct: 28 GKVQAVDVEAQRKLCFLPLCFKIKRKYFCTLCSRRLVLDY 67 >ref|XP_006587000.1| PREDICTED: uncharacterized protein LOC100819590 [Glycine max] gi|734411210|gb|KHN35822.1| hypothetical protein glysoja_013247 [Glycine soja] Length = 67 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 272 GKVQAIDVETQWKFCFLPLCFKIKRKYFCTLCARRLVLYY 153 GKV+A+DVE QW+ CFLP+CFKIKRK+FCT CARRL LYY Sbjct: 28 GKVEAMDVEIQWRLCFLPMCFKIKRKFFCTSCARRLELYY 67