BLASTX nr result
ID: Ziziphus21_contig00037161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037161 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC16734.1| arabinogalactan protein [Daucus carota] 83 9e-14 >emb|CAC16734.1| arabinogalactan protein [Daucus carota] Length = 242 Score = 82.8 bits (203), Expect = 9e-14 Identities = 39/55 (70%), Positives = 41/55 (74%) Frame = -1 Query: 256 PEKKCDKPTNLRYGVKGAILERXXXXXXXXXXXXXSEMFNVGPFAFEPSTKKPCS 92 PEKKCDKPTNLRYGVKGAILE+ EMF+VGPFAFEPSTKKPCS Sbjct: 187 PEKKCDKPTNLRYGVKGAILEKSTKPPVSTKTPATFEMFSVGPFAFEPSTKKPCS 241