BLASTX nr result
ID: Ziziphus21_contig00037152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00037152 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008224655.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_010052500.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 >ref|XP_008224655.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Prunus mume] Length = 668 Score = 72.0 bits (175), Expect = 2e-10 Identities = 41/69 (59%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = +2 Query: 158 GFVHRTLASCPFGTSAAPALFSDSE--SGGNDCYASGVIQDKDLLRKSYGGSGTGLHVLD 331 G +L++ TSA A +DSE S G D YAS +IQDKDLLRKS SGTGLHVLD Sbjct: 23 GIQKLSLSAAQLRTSATRASCTDSEEISEGEDWYASHIIQDKDLLRKSLHNSGTGLHVLD 82 Query: 332 LIDRGSLEA 358 L++RGSLEA Sbjct: 83 LVNRGSLEA 91 >ref|XP_010052500.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Eucalyptus grandis] Length = 658 Score = 60.8 bits (146), Expect = 4e-07 Identities = 38/80 (47%), Positives = 49/80 (61%), Gaps = 6/80 (7%) Frame = +2 Query: 134 CSKVRDFGGFVH-RTLASCPFGTSAAPALFSD-----SESGGNDCYASGVIQDKDLLRKS 295 C K+ F + R++ S P +SAA A FSD +ES + C +IQ KDLLR+S Sbjct: 7 CRKIVSFDKYATARSVVSRPITSSAAHAAFSDPDAPEAESSDDPC----IIQTKDLLRRS 62 Query: 296 YGGSGTGLHVLDLIDRGSLE 355 SGTGLHVLDL+DRG L+ Sbjct: 63 SNRSGTGLHVLDLLDRGLLQ 82