BLASTX nr result
ID: Ziziphus21_contig00036943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036943 (251 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59438.1| Rps16 protein [Clivia gardenii] 62 2e-07 >emb|CAD59438.1| Rps16 protein [Clivia gardenii] Length = 74 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 138 IVHDGARVKSIDSFLGGKNLGLVLINKLGQLRKYI 242 IVHDGAR KSIDSF+GGKNLGLV INKL QL KYI Sbjct: 25 IVHDGARTKSIDSFIGGKNLGLVTINKLDQLCKYI 59