BLASTX nr result
ID: Ziziphus21_contig00036812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036812 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010110954.1| hypothetical protein L484_021648 [Morus nota... 80 6e-13 >ref|XP_010110954.1| hypothetical protein L484_021648 [Morus notabilis] gi|587942804|gb|EXC29340.1| hypothetical protein L484_021648 [Morus notabilis] Length = 334 Score = 80.1 bits (196), Expect = 6e-13 Identities = 47/102 (46%), Positives = 61/102 (59%), Gaps = 1/102 (0%) Frame = +2 Query: 5 SEIHN-HSFLSSATSTTRCTPAPSSFPSDPLFTLGYSGVCQFNTDQFRSFRDGMPFSGNI 181 +EIH ++F +A++ T CT PS+ P++P +G VCQFNT+Q RSF G FSGN Sbjct: 142 AEIHQLNTFSGTASAPTYCTN-PSAIPANPSLLMGPGNVCQFNTNQSRSFMGGGQFSGNA 200 Query: 182 LPNFQPLNPTSLPYPAYAIAVPDPSLDSYQLPDFKESTGMVS 307 LP FQ LN YA+AVP P L S Q P F+ T + S Sbjct: 201 LPQFQYLN-----QGIYAVAVPGPLLSSNQQPSFRGPTNIGS 237