BLASTX nr result
ID: Ziziphus21_contig00036754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036754 (244 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009377358.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008347695.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008219809.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_010095467.1| hypothetical protein L484_014894 [Morus nota... 58 3e-06 ref|XP_004305601.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_009377358.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Pyrus x bretschneideri] Length = 564 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 132 MALAIACGESSPSHLVLLGFLNRTLDSIKRNIAQIFANVFCSQ 4 MAL IACGESSPSH+ LL LNRTLDSIK NIA+IF N+ C Q Sbjct: 1 MALVIACGESSPSHIALLRCLNRTLDSIKHNIARIFVNILCCQ 43 >ref|XP_008347695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830-like [Malus domestica] Length = 564 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 132 MALAIACGESSPSHLVLLGFLNRTLDSIKRNIAQIFANVFCSQ 4 MAL IACGESSPSH+ LL LNRTLDSIK NIA+IF N+ C Q Sbjct: 1 MALVIACGESSPSHIALLRCLNRTLDSIKHNIARIFVNILCCQ 43 >ref|XP_008219809.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Prunus mume] Length = 589 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 132 MALAIACGESSPSHLVLLGFLNRTLDSIKRNIAQIFANVFCSQ 4 MAL IACGESSPSH+ LL LNRTLDSIK NIA+IF N+ C Q Sbjct: 1 MALVIACGESSPSHITLLRCLNRTLDSIKHNIARIFVNILCCQ 43 >ref|XP_010095467.1| hypothetical protein L484_014894 [Morus notabilis] gi|587871174|gb|EXB60441.1| hypothetical protein L484_014894 [Morus notabilis] Length = 591 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 123 AIACGESSPSHLVLLGFLNRTLDSIKRNIAQIFANVFCSQ 4 AI CGESSPS++ L LNRT+DSIK NIAQIFAN+F S+ Sbjct: 17 AIVCGESSPSYISFLRTLNRTVDSIKDNIAQIFANIFYSR 56 >ref|XP_004305601.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Fragaria vesca subsp. vesca] Length = 589 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 132 MALAIACGESSPSHLVLLGFLNRTLDSIKRNIAQIFANVFCSQ 4 MA AI CGE+SPS++ L LNRTLDSIK NIA IFAN+ Q Sbjct: 1 MACAIVCGEASPSYVTLFRSLNRTLDSIKDNIAVIFANILACQ 43