BLASTX nr result
ID: Ziziphus21_contig00036672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036672 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004309817.1| PREDICTED: ABC transporter C family member 3... 56 9e-06 >ref|XP_004309817.1| PREDICTED: ABC transporter C family member 3-like [Fragaria vesca subsp. vesca] Length = 1506 Score = 56.2 bits (134), Expect = 9e-06 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = -3 Query: 186 LEPFGSSKVGYVKLL*LMFSGTKFVLNLVFIRGFSGSLHLVLLFGLFISCLCKKFRLIHG 7 +EPF SS + V M SGT F++ +FIRGFSGSLHL++LF L IS L KF++ G Sbjct: 1 MEPFDSSLLHTVSAF--MSSGTDFLVKPIFIRGFSGSLHLLVLFVLLISWLWNKFKVGDG 58 Query: 6 RG 1 G Sbjct: 59 GG 60