BLASTX nr result
ID: Ziziphus21_contig00036671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036671 (466 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045715.1| orf127a (mitochondrion) [Batis maritima] gi|... 71 4e-10 >ref|YP_009045715.1| orf127a (mitochondrion) [Batis maritima] gi|655168489|gb|AIC83318.1| orf127a (mitochondrion) [Batis maritima] Length = 127 Score = 70.9 bits (172), Expect = 4e-10 Identities = 39/55 (70%), Positives = 40/55 (72%) Frame = -1 Query: 415 KTGIVTSRSAVVSLTLCLTGESAVSTAFPFAGSSSSLRVPIFAWAVSRRSSIRTF 251 KTGIV R AVVSLT+CLTGESAVSTAFPFAG SSLRVPIF R S F Sbjct: 21 KTGIVNPRFAVVSLTVCLTGESAVSTAFPFAGCFSSLRVPIFVRLGRLRGSTLAF 75