BLASTX nr result
ID: Ziziphus21_contig00036670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00036670 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09756.1| hypothetical protein B456_001G162300 [Gossypium r... 82 2e-13 gb|KCW59986.1| hypothetical protein EUGRSUZ_H02718 [Eucalyptus g... 52 6e-09 >gb|KJB09756.1| hypothetical protein B456_001G162300 [Gossypium raimondii] Length = 1286 Score = 82.0 bits (201), Expect = 2e-13 Identities = 41/64 (64%), Positives = 43/64 (67%) Frame = -2 Query: 262 KHCGHHSSSYVWLAYNLRAS*PKEQKKKDAGTFSPILDKEQGGYEALLGRPWLQPGHDWA 83 KHCGHHSSSYVWLAYNLRAS PILDKE+GGYEALLGRPW +PG Sbjct: 1190 KHCGHHSSSYVWLAYNLRAS-------------YPILDKEKGGYEALLGRPWSKPGWFMT 1236 Query: 82 NKKK 71 KK Sbjct: 1237 RLKK 1240 >gb|KCW59986.1| hypothetical protein EUGRSUZ_H02718 [Eucalyptus grandis] Length = 66 Score = 51.6 bits (122), Expect(2) = 6e-09 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +1 Query: 193 LLAKKPVGCTPAIRSLNCDGHN 258 LLAKKPVGCTPAIRSLNCDGHN Sbjct: 44 LLAKKPVGCTPAIRSLNCDGHN 65 Score = 35.4 bits (80), Expect(2) = 6e-09 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = +3 Query: 135 PPCSLSKIGLKVPASFFFC 191 PPCSLSKIGLKVP FC Sbjct: 22 PPCSLSKIGLKVPKQASFC 40