BLASTX nr result
ID: Ziziphus21_contig00035479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035479 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005651480.1| hypothetical protein COCSUDRAFT_59434 [Cocco... 58 3e-06 >ref|XP_005651480.1| hypothetical protein COCSUDRAFT_59434 [Coccomyxa subellipsoidea C-169] gi|384253461|gb|EIE26936.1| hypothetical protein COCSUDRAFT_59434 [Coccomyxa subellipsoidea C-169] Length = 437 Score = 57.8 bits (138), Expect = 3e-06 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Frame = -3 Query: 247 FFPVGLNGAIRTPTGYNLSASGVQSCXXXXXXXXXTVA--QVGTLNPPITAAGPFTVPGE 74 FFP GL GAI PTGYN +ASG+ S ++ Q+GT+ P P V GE Sbjct: 320 FFPNGLGGAINKPTGYNETASGLDSFPASGAKVATQLSTEQIGTIPGP---KPPANVTGE 376 Query: 73 LDLTQGIAGPLANASYLSRGY 11 LDLTQ + G N + +RGY Sbjct: 377 LDLTQSLTGGKDNETAATRGY 397