BLASTX nr result
ID: Ziziphus21_contig00035459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035459 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101366.1| Probably inactive leucine-rich repeat recept... 62 1e-07 >ref|XP_010101366.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] gi|587899942|gb|EXB88313.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 2189 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/77 (49%), Positives = 53/77 (68%), Gaps = 4/77 (5%) Frame = -2 Query: 219 WLQAIQLVMQMISLSMV---GNKKRNKANQWNLLKTLNGK-EYTRLEKLVNKISFTELVN 52 WLQ ++ +++MI SMV +R +A+Q L TL K E ++LEKLVN++SFTEL Sbjct: 252 WLQ-VKSIIKMILFSMVPVQNRLRRKEADQLLHLPTLKNKYEVSQLEKLVNRMSFTELSK 310 Query: 51 ATDDFNVANVIGRGKMG 1 ATD+F+ NVIG+GK G Sbjct: 311 ATDNFSEDNVIGKGKTG 327