BLASTX nr result
ID: Ziziphus21_contig00035409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035409 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010268552.1| PREDICTED: G-type lectin S-receptor-like ser... 57 4e-06 >ref|XP_010268552.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase B120 [Nelumbo nucifera] Length = 443 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +3 Query: 75 ELKTSMASIDELSGANKQKSNGKQDHELPLFNFPTIETATRYFSCENKLGQG 230 +LK ++A+ DE S N + +GK+DHELPLF+F ++ETAT +FS NKLG+G Sbjct: 101 QLKGNVAT-DEFSSTNMLQLDGKRDHELPLFSFCSLETATDHFSAGNKLGEG 151