BLASTX nr result
ID: Ziziphus21_contig00035313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035313 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301227.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_008240417.1| PREDICTED: pentatricopeptide repeat-containi... 73 9e-11 ref|XP_008393489.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_010270723.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_007210149.1| hypothetical protein PRUPE_ppa024340mg [Prun... 59 2e-06 >ref|XP_004301227.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Fragaria vesca subsp. vesca] Length = 808 Score = 76.6 bits (187), Expect = 7e-12 Identities = 41/78 (52%), Positives = 55/78 (70%) Frame = -2 Query: 235 NQFTTQLAIRAQQSSSHQSTPLISLLEACHRSKSLSQAKKIHQLLLKNKTHIEERCQLFE 56 + FTT A Q SS+ I+LLEAC RSKSL+QAK IHQ L+K KTHIE R L + Sbjct: 15 HHFTTLRATTTQTYSSNY----INLLEACIRSKSLAQAKTIHQHLIKTKTHIESRSLLLD 70 Query: 55 KLAQVYIACDEVELARHL 2 KLA++Y+ C+++++AR L Sbjct: 71 KLARLYLTCNQLDVARRL 88 >ref|XP_008240417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Prunus mume] Length = 824 Score = 72.8 bits (177), Expect = 9e-11 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 12/110 (10%) Frame = -2 Query: 304 MLW--RARRFIHRQQLQKALIFFFSNQFTTQ------LAIRAQQSSSHQSTPLIS----L 161 MLW ARR RQ F +QFTTQ LA S++ T L S L Sbjct: 1 MLWLATARRLTRRQ---------FVDQFTTQPLALVILATTTHGFSTNTLTSLDSYYANL 51 Query: 160 LEACHRSKSLSQAKKIHQLLLKNKTHIEERCQLFEKLAQVYIACDEVELA 11 ++AC RSKSL QAKKIHQ LLKN T +++ L EK+A +YIAC++V+LA Sbjct: 52 VQACIRSKSLPQAKKIHQHLLKNTTRLKDTSFLLEKVAHLYIACNQVDLA 101 >ref|XP_008393489.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Malus domestica] Length = 819 Score = 70.9 bits (172), Expect = 4e-10 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 5/103 (4%) Frame = -2 Query: 304 MLWRARRFIHRQQLQ-----KALIFFFSNQFTTQLAIRAQQSSSHQSTPLISLLEACHRS 140 ML RR + R + Q + + ++ F+T R H LLEAC RS Sbjct: 1 MLCFGRRSLSRSRSQCYHTTQQAVVILTHNFSTNTLTRLDFDYKH-------LLEACIRS 53 Query: 139 KSLSQAKKIHQLLLKNKTHIEERCQLFEKLAQVYIACDEVELA 11 KSL Q KKIHQLLLKN TH+++ L EK+A +YI C++++LA Sbjct: 54 KSLPQGKKIHQLLLKNTTHLKDSSFLLEKVAHLYITCNQLQLA 96 >ref|XP_010270723.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] gi|720047149|ref|XP_010270724.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] gi|720047152|ref|XP_010270725.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] gi|720047155|ref|XP_010270726.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] gi|720047158|ref|XP_010270727.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] gi|720047161|ref|XP_010270728.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Nelumbo nucifera] Length = 848 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -2 Query: 163 LLEACHRSKSLSQAKKIHQLLLKNKTHIEERCQLFEKLAQVYIACDEVELARHL 2 LLEAC RSKSLS +KIHQ LLKN THI L EKL ++Y+ C EVELAR++ Sbjct: 76 LLEACIRSKSLSGGEKIHQYLLKNNTHIRSSIVL-EKLTRLYVECGEVELARNV 128 >ref|XP_007210149.1| hypothetical protein PRUPE_ppa024340mg [Prunus persica] gi|462405884|gb|EMJ11348.1| hypothetical protein PRUPE_ppa024340mg [Prunus persica] Length = 840 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -2 Query: 151 CHRSKSLSQAKKIHQLLLKNKTHIEERCQLFEKLAQVYIACDEVELA 11 C RSKSL QAKKIHQ LLKN T +++ L EK+A +YI C++V+LA Sbjct: 71 CIRSKSLPQAKKIHQHLLKNTTRLKDTSFLLEKVAHLYITCNQVDLA 117