BLASTX nr result
ID: Ziziphus21_contig00035288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035288 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADZ36804.1| hypothetical protein [Chlorella vulgaris] 60 6e-07 gb|ADZ36799.1| hypothetical protein [Chlorella vulgaris] gi|3256... 58 3e-06 ref|XP_011395779.1| hypothetical protein F751_6422 [Auxenochlore... 57 4e-06 ref|XP_005846506.1| hypothetical protein CHLNCDRAFT_135735 [Chlo... 57 4e-06 >gb|ADZ36804.1| hypothetical protein [Chlorella vulgaris] Length = 156 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -3 Query: 176 TCDRQYYTTTEDRQRVLEQRELIREHHPFEKEFVIETKPTGRERALERPQSEV 18 TC ++Y+T TEDR V E+ ELI+EH P EKEFV+ET+ TG ER E P EV Sbjct: 86 TCAQEYFTKTEDRPVVKERVELIQEHRPVEKEFVVETRATGVER--EIPGGEV 136 >gb|ADZ36799.1| hypothetical protein [Chlorella vulgaris] gi|325611177|gb|ADZ36812.1| hypothetical protein [Chlorella vulgaris] Length = 174 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 176 TCDRQYYTTTEDRQRVLEQRELIREHHPFEKEFVIETKPTGRER 45 TC +++T TEDR V E+ ELI+EH P EKEFV+ET+ TG ER Sbjct: 104 TCTTEHFTKTEDRPVVKERVELIQEHRPVEKEFVVETRATGEER 147 >ref|XP_011395779.1| hypothetical protein F751_6422 [Auxenochlorella protothecoides] gi|675350473|gb|KFM22913.1| hypothetical protein F751_6422 [Auxenochlorella protothecoides] Length = 223 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 167 RQYYTTTEDRQRVLEQRELIREHHPFEKEFVIETKPTGRERAL 39 + YYT TEDR V E+ E IREH P EKEFV+ET+ TG ER L Sbjct: 138 QDYYTNTEDRSLVKERVEQIREHRPVEKEFVVETRATGNERDL 180 >ref|XP_005846506.1| hypothetical protein CHLNCDRAFT_135735 [Chlorella variabilis] gi|307106157|gb|EFN54404.1| hypothetical protein CHLNCDRAFT_135735 [Chlorella variabilis] Length = 369 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -3 Query: 173 CDRQYYTTTEDRQRVLEQRELIREHHPFEKEFVIETKPTGRERAL-ERPQSEV 18 C R+Y+T EDR + E+ +REHHP EKEFV+ET+ TG ER ER Q ++ Sbjct: 231 CGREYFTKVEDRPVMKERVTRLREHHPVEKEFVVETRATGEERETGERAQEQM 283