BLASTX nr result
ID: Ziziphus21_contig00035249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035249 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008230533.1| PREDICTED: protein kinase PVPK-1 [Prunus mum... 57 4e-06 ref|XP_007217638.1| hypothetical protein PRUPE_ppa002420mg [Prun... 57 4e-06 >ref|XP_008230533.1| PREDICTED: protein kinase PVPK-1 [Prunus mume] gi|645248971|ref|XP_008230534.1| PREDICTED: protein kinase PVPK-1 [Prunus mume] Length = 674 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 139 MESLSHGADSSLKIQNSASVIDNNPPSTSGTHHPSRAPSPKQSRNE 2 MESL+ G DS K +SA + NNPPST+GT PS+ PSPKQSR+E Sbjct: 1 MESLADGVDSLSKTCHSAPDVGNNPPSTTGTPRPSQPPSPKQSRSE 46 >ref|XP_007217638.1| hypothetical protein PRUPE_ppa002420mg [Prunus persica] gi|462413788|gb|EMJ18837.1| hypothetical protein PRUPE_ppa002420mg [Prunus persica] Length = 674 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 139 MESLSHGADSSLKIQNSASVIDNNPPSTSGTHHPSRAPSPKQSRNE 2 MESL+ G DS K +SA + NNPPST+GT PS+ PSPKQSR+E Sbjct: 1 MESLADGVDSLSKTCHSAPDVGNNPPSTTGTPRPSQPPSPKQSRSE 46