BLASTX nr result
ID: Ziziphus21_contig00035189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035189 (225 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853795.1| PREDICTED: uncharacterized protein LOC105973... 53 3e-06 ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein A... 57 5e-06 ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein A... 57 5e-06 emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 56 9e-06 >ref|XP_012853795.1| PREDICTED: uncharacterized protein LOC105973319 [Erythranthe guttatus] Length = 1280 Score = 52.8 bits (125), Expect(2) = 3e-06 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = -2 Query: 146 ISWLRMCRLKEMGVLGFQGFKDVNMALVAKLGWKIASEEDSLWIRLMK 3 +SW R+C K +G +GF+ K N+AL+AK GW+I + DSL RL+K Sbjct: 824 MSWNRLCEPKSLGGMGFRDLKSFNIALLAKQGWRILTNPDSLLSRLLK 871 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 225 LLPNNVYEDLDACVRKFW 172 +LP ++ D++A +R+FW Sbjct: 795 VLPYSLIRDIEAAIRRFW 812 >ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica rapa] Length = 1011 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/51 (41%), Positives = 38/51 (74%) Frame = -2 Query: 155 KRLISWLRMCRLKEMGVLGFQGFKDVNMALVAKLGWKIASEEDSLWIRLMK 3 + L+SW ++C+ K G LG +G +D+N AL+AK+GW++ + +SLW R+++ Sbjct: 475 QHLVSWEKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVLR 525 >ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica rapa] Length = 782 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/51 (41%), Positives = 38/51 (74%) Frame = -2 Query: 155 KRLISWLRMCRLKEMGVLGFQGFKDVNMALVAKLGWKIASEEDSLWIRLMK 3 + L+SW ++C+ K G LG +G +D+N AL+AK+GW++ + +SLW R+++ Sbjct: 246 QHLVSWEKICKPKAEGGLGIRGSRDMNKALIAKVGWRLLRDTESLWARVLR 296 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/51 (43%), Positives = 38/51 (74%) Frame = -2 Query: 155 KRLISWLRMCRLKEMGVLGFQGFKDVNMALVAKLGWKIASEEDSLWIRLMK 3 + L+SW ++CR K G LG + KD+N AL+AK+GW++ +++ SLW R+++ Sbjct: 634 QHLLSWKKVCRPKAAGGLGLRASKDMNRALLAKVGWRLLNDKVSLWARVLR 684