BLASTX nr result
ID: Ziziphus21_contig00035174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035174 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010099143.1| Ankyrin repeat-containing protein [Morus not... 74 4e-11 ref|XP_011047004.1| PREDICTED: uncharacterized protein LOC105141... 67 7e-09 ref|XP_007018184.1| Ankyrin repeat family protein, putative [The... 66 1e-08 ref|XP_011033186.1| PREDICTED: ankyrin repeat-containing protein... 64 3e-08 ref|XP_006389000.1| hypothetical protein POPTR_0062s00200g [Popu... 63 1e-07 ref|XP_007026201.1| Ankyrin repeat family protein, putative [The... 63 1e-07 ref|XP_006377157.1| hypothetical protein POPTR_0011s01260g, part... 62 2e-07 ref|XP_011014439.1| PREDICTED: uncharacterized protein LOC105118... 60 5e-07 ref|XP_002321803.1| hypothetical protein POPTR_0015s15570g [Popu... 60 5e-07 ref|XP_006377151.1| hypothetical protein POPTR_0011s01170g [Popu... 60 5e-07 ref|XP_011011253.1| PREDICTED: ankyrin repeat-containing protein... 58 3e-06 ref|XP_011011252.1| PREDICTED: uncharacterized protein LOC105115... 58 3e-06 ref|XP_011011249.1| PREDICTED: uncharacterized protein LOC105115... 58 3e-06 ref|XP_002526408.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 ref|XP_011011254.1| PREDICTED: ankyrin repeat-containing protein... 57 4e-06 ref|XP_011011251.1| PREDICTED: uncharacterized protein LOC105115... 57 4e-06 ref|XP_011008858.1| PREDICTED: uncharacterized protein LOC105114... 57 4e-06 ref|XP_011008856.1| PREDICTED: uncharacterized protein LOC105114... 57 4e-06 ref|XP_011008855.1| PREDICTED: uncharacterized protein LOC105114... 57 4e-06 ref|XP_011015017.1| PREDICTED: uncharacterized protein LOC105118... 57 5e-06 >ref|XP_010099143.1| Ankyrin repeat-containing protein [Morus notabilis] gi|587888307|gb|EXB77015.1| Ankyrin repeat-containing protein [Morus notabilis] Length = 722 Score = 73.9 bits (180), Expect = 4e-11 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 2/78 (2%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNG--D 56 LL++D I D +D G +C QLLANMPSAF+SGY M KL S +Y+CLP +YD+D+ Sbjct: 181 LLRHD-ISPDSIDENGMTCFQLLANMPSAFRSGYSMGKLASLLYYCLPEKDYDEDDDIVP 239 Query: 55 QMNLRKCNDLESGPGRNR 2 Q DLESG G ++ Sbjct: 240 QHASSGKKDLESGQGSSQ 257 >ref|XP_011047004.1| PREDICTED: uncharacterized protein LOC105141473 [Populus euphratica] Length = 685 Score = 66.6 bits (161), Expect = 7e-09 Identities = 40/89 (44%), Positives = 47/89 (52%), Gaps = 19/89 (21%) Frame = -2 Query: 217 DEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDN--GD---- 56 D L +D G SCLQLLA+MPSAFKSGYPM L +YFCLP DDD GD Sbjct: 186 DAHLPGAVDENGMSCLQLLASMPSAFKSGYPMGMLRKLLYFCLPDIGGDDDKELGDSDDD 245 Query: 55 -------------QMNLRKCNDLESGPGR 8 +++ + DLESG GR Sbjct: 246 KELDDSDDVKESGKLHSSQGQDLESGHGR 274 >ref|XP_007018184.1| Ankyrin repeat family protein, putative [Theobroma cacao] gi|508723512|gb|EOY15409.1| Ankyrin repeat family protein, putative [Theobroma cacao] Length = 684 Score = 65.9 bits (159), Expect = 1e-08 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPS-NEYDDDNGDQ 53 LL+ND L +L + +CLQLLANMP+AF+SG M+K + +YFCLP +YDD+ G Q Sbjct: 170 LLENDRELIELEEQSVTTCLQLLANMPTAFRSGCYMNKWQRLLYFCLPDCEDYDDNYGAQ 229 Query: 52 MNLRKC--NDLESG 17 + L ND E G Sbjct: 230 VPLSSSQGNDCEKG 243 >ref|XP_011033186.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus euphratica] gi|743788311|ref|XP_011033193.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus euphratica] gi|743788315|ref|XP_011033202.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus euphratica] Length = 560 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/75 (44%), Positives = 48/75 (64%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL+ D+ LG L D++G++CL LLA +PSAFKSG+ MS ++Y CLP + D+ ++ Sbjct: 67 LLELDKSLGRLPDSRGKTCLGLLAEIPSAFKSGHSMSIFSRYLYMCLPVEDECDEAINED 126 Query: 49 NLRKCNDLESGPGRN 5 R +ESG RN Sbjct: 127 TSRVWEAMESGRKRN 141 >ref|XP_006389000.1| hypothetical protein POPTR_0062s00200g [Populus trichocarpa] gi|550311564|gb|ERP47914.1| hypothetical protein POPTR_0062s00200g [Populus trichocarpa] Length = 326 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGD-Q 53 LL+ DE L L DNK R+ LQLLA MP+ F+SGYPM E IY CLP + + Q Sbjct: 177 LLELDESLHSLKDNKNRTVLQLLAEMPTGFESGYPMGIFERLIYSCLPVIRHHEVKSQVQ 236 Query: 52 MNLRKCNDLESG 17 R DLESG Sbjct: 237 PWCRAMKDLESG 248 >ref|XP_007026201.1| Ankyrin repeat family protein, putative [Theobroma cacao] gi|508781567|gb|EOY28823.1| Ankyrin repeat family protein, putative [Theobroma cacao] Length = 692 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/69 (44%), Positives = 43/69 (62%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL D+ L D G++ L LLA MP+AFKS PM +L++FIY C PS+ DD+ + Sbjct: 201 LLNKDQQLATYKDRNGKTILHLLAKMPTAFKSTTPMIRLKAFIYNCFPSHSDDDNEAGLL 260 Query: 49 NLRKCNDLE 23 + + NDLE Sbjct: 261 SSSQNNDLE 269 >ref|XP_006377157.1| hypothetical protein POPTR_0011s01260g, partial [Populus trichocarpa] gi|550327300|gb|ERP54954.1| hypothetical protein POPTR_0011s01260g, partial [Populus trichocarpa] Length = 279 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSN---EYDDDNG 59 LL+ DE L L D KG + LQLLA MPSAF+SG+PM E IY CLP + ++ Sbjct: 185 LLELDESLHSLKDRKGITALQLLAQMPSAFESGFPMGIFERLIYCCLPVRRKVKLQEETS 244 Query: 58 DQMNLRKCNDLESGPG 11 Q D+ESG G Sbjct: 245 GQSRKGTVGDVESGLG 260 >ref|XP_011014439.1| PREDICTED: uncharacterized protein LOC105118237 [Populus euphratica] Length = 431 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/71 (47%), Positives = 43/71 (60%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL+ DE L +L D GR+ L+LLA MP+ F+SGYPM E IY CLP + + Q Sbjct: 216 LLELDESLHNLEDKMGRTALKLLAEMPTGFESGYPMGIFERLIYSCLPVIRHHEVK-SQT 274 Query: 49 NLRKCNDLESG 17 R+ DLESG Sbjct: 275 WCREMKDLESG 285 >ref|XP_002321803.1| hypothetical protein POPTR_0015s15570g [Populus trichocarpa] gi|222868799|gb|EEF05930.1| hypothetical protein POPTR_0015s15570g [Populus trichocarpa] Length = 265 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD 65 +LLK D L D+ D +GR+CL LLA MPSAFKSG M K + + IY CL ++ DDD Sbjct: 198 TLLKRDPSLDDMTDEQGRTCLHLLAEMPSAFKSGRAMLKYSIRNLIYCCLSASNGDDD 255 >ref|XP_006377151.1| hypothetical protein POPTR_0011s01170g [Populus trichocarpa] gi|566193048|ref|XP_006377152.1| hypothetical protein POPTR_0011s01170g [Populus trichocarpa] gi|550327292|gb|ERP54948.1| hypothetical protein POPTR_0011s01170g [Populus trichocarpa] gi|550327293|gb|ERP54949.1| hypothetical protein POPTR_0011s01170g [Populus trichocarpa] Length = 282 Score = 60.5 bits (145), Expect = 5e-07 Identities = 35/72 (48%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGD-Q 53 LL+ DE L DL D GR+ LQLLA MP+ F+SGYPM E IY CLP + + Sbjct: 187 LLELDESLHDLEDKMGRTALQLLAEMPTGFESGYPMGICERLIYCCLPVIRHHKVKSQVE 246 Query: 52 MNLRKCNDLESG 17 R DLESG Sbjct: 247 SWCRAMKDLESG 258 >ref|XP_011011253.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform X4 [Populus euphratica] Length = 658 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 13/73 (17%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD-- 65 +LLK D L D+ D +GR+CL LLA MP AFKSG M K + + IY+CL ++ D D Sbjct: 196 TLLKRDPSLDDMKDEQGRTCLHLLAEMPRAFKSGCAMPKYSIRNLIYYCLSASNGDVDQS 255 Query: 64 ---------NGDQ 53 NGDQ Sbjct: 256 KSKKGHSSANGDQ 268 >ref|XP_011011252.1| PREDICTED: uncharacterized protein LOC105115881 isoform X3 [Populus euphratica] Length = 776 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 13/73 (17%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD-- 65 +LLK D L D+ D +GR+CL LLA MP AFKSG M K + + IY+CL ++ D D Sbjct: 196 TLLKRDPSLDDMKDEQGRTCLHLLAEMPRAFKSGCAMPKYSIRNLIYYCLSASNGDVDQS 255 Query: 64 ---------NGDQ 53 NGDQ Sbjct: 256 KSKKGHSSANGDQ 268 >ref|XP_011011249.1| PREDICTED: uncharacterized protein LOC105115881 isoform X1 [Populus euphratica] gi|743933845|ref|XP_011011250.1| PREDICTED: uncharacterized protein LOC105115881 isoform X1 [Populus euphratica] Length = 794 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 13/73 (17%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD-- 65 +LLK D L D+ D +GR+CL LLA MP AFKSG M K + + IY+CL ++ D D Sbjct: 196 TLLKRDPSLDDMKDEQGRTCLHLLAEMPRAFKSGCAMPKYSIRNLIYYCLSASNGDVDQS 255 Query: 64 ---------NGDQ 53 NGDQ Sbjct: 256 KSKKGHSSANGDQ 268 >ref|XP_002526408.1| conserved hypothetical protein [Ricinus communis] gi|223534270|gb|EEF35984.1| conserved hypothetical protein [Ricinus communis] Length = 291 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFC 92 L + DE LG+L D GR+CL LLANM SA+KSG PM KL Y C Sbjct: 241 LQRTDEALGELKDENGRTCLHLLANMRSAYKSGQPMGKLMGLFYNC 286 >ref|XP_011011254.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform X5 [Populus euphratica] Length = 644 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD 65 +LLK D L D+ D +GR+CL LLA MP AFKSG M K + + IY+CL ++ D D Sbjct: 196 TLLKRDPSLDDMKDEQGRTCLHLLAEMPRAFKSGCAMPKYSIRNLIYYCLSASNGDVD 253 >ref|XP_011011251.1| PREDICTED: uncharacterized protein LOC105115881 isoform X2 [Populus euphratica] Length = 780 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 232 SLLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSK--LESFIYFCLPSNEYDDD 65 +LLK D L D+ D +GR+CL LLA MP AFKSG M K + + IY+CL ++ D D Sbjct: 196 TLLKRDPSLDDMKDEQGRTCLHLLAEMPRAFKSGCAMPKYSIRNLIYYCLSASNGDVD 253 >ref|XP_011008858.1| PREDICTED: uncharacterized protein LOC105114125 isoform X4 [Populus euphratica] gi|743929264|ref|XP_011008860.1| PREDICTED: uncharacterized protein LOC105114125 isoform X4 [Populus euphratica] Length = 643 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL+ D+ L +L D S LQLLA MP+AF+SG+PM E I+ CLP + + Sbjct: 176 LLELDKSLANLKDKNQISTLQLLAEMPAAFESGFPMGIFERLIHCCLPVKRHHEVKSQVQ 235 Query: 49 NLRKCN--DLESGPGRN 5 N DLESG GRN Sbjct: 236 TWCPENKRDLESGRGRN 252 >ref|XP_011008856.1| PREDICTED: uncharacterized protein LOC105114125 isoform X2 [Populus euphratica] Length = 784 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL+ D+ L +L D S LQLLA MP+AF+SG+PM E I+ CLP + + Sbjct: 317 LLELDKSLANLKDKNQISTLQLLAEMPAAFESGFPMGIFERLIHCCLPVKRHHEVKSQVQ 376 Query: 49 NLRKCN--DLESGPGRN 5 N DLESG GRN Sbjct: 377 TWCPENKRDLESGRGRN 393 >ref|XP_011008855.1| PREDICTED: uncharacterized protein LOC105114125 isoform X1 [Populus euphratica] Length = 786 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLPSNEYDDDNGDQM 50 LL+ D+ L +L D S LQLLA MP+AF+SG+PM E I+ CLP + + Sbjct: 319 LLELDKSLANLKDKNQISTLQLLAEMPAAFESGFPMGIFERLIHCCLPVKRHHEVKSQVQ 378 Query: 49 NLRKCN--DLESGPGRN 5 N DLESG GRN Sbjct: 379 TWCPENKRDLESGRGRN 395 >ref|XP_011015017.1| PREDICTED: uncharacterized protein LOC105118705 [Populus euphratica] Length = 665 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -2 Query: 229 LLKNDEILGDLMDNKGRSCLQLLANMPSAFKSGYPMSKLESFIYFCLP 86 LL+ DE L L D KG + LQLLA+MPSAF+SG+PM E IY CLP Sbjct: 178 LLELDESLLSLKDKKGITVLQLLAHMPSAFESGFPMGIFERLIYCCLP 225