BLASTX nr result
ID: Ziziphus21_contig00035154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035154 (480 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO80268.1| hypothetical protein CISIN_1g047840mg [Citrus sin... 71 3e-10 ref|XP_006475832.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_004288805.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_006450944.1| hypothetical protein CICLE_v100105921mg, par... 70 5e-10 ref|XP_007202004.1| hypothetical protein PRUPE_ppa021060mg, part... 70 8e-10 ref|XP_008242855.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_002282063.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] 69 1e-09 ref|XP_014495112.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_010047826.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_013443472.1| PPR containing plant-like protein [Medicago ... 67 7e-09 gb|KCW79820.1| hypothetical protein EUGRSUZ_C01164, partial [Euc... 67 7e-09 ref|XP_007138308.1| hypothetical protein PHAVU_009G197700g [Phas... 66 9e-09 ref|XP_004152427.2| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_011093560.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008437069.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008437067.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 gb|KGN50259.1| hypothetical protein Csa_5G162080 [Cucumis sativus] 66 1e-08 gb|KHN08393.1| Pentatricopeptide repeat-containing protein [Glyc... 65 2e-08 ref|XP_003525932.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 >gb|KDO80268.1| hypothetical protein CISIN_1g047840mg [Citrus sinensis] Length = 445 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGKMGD +NAR+LFE+MP+R+A+SWSAIMAAYSR++ + + L R Sbjct: 104 VDGYGKMGDFENARELFEKMPERNAVSWSAIMAAYSRISDFKEVLSLFR 152 >ref|XP_006475832.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 527 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGKMGD +NAR+LFE+MP+R+A+SWSAIMAAYSR++ + + L R Sbjct: 186 VDGYGKMGDFENARELFEKMPERNAVSWSAIMAAYSRISDFKEVLSLFR 234 >ref|XP_004288805.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Fragaria vesca subsp. vesca] Length = 525 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/49 (63%), Positives = 43/49 (87%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGK+GDV+NAR++F+EMP+R+A+SWSA+MAAYSRV+ + + L R Sbjct: 182 VDGYGKIGDVENARKVFDEMPERNAVSWSAMMAAYSRVSGFREVICLFR 230 >ref|XP_006450944.1| hypothetical protein CICLE_v100105921mg, partial [Citrus clementina] gi|557554170|gb|ESR64184.1| hypothetical protein CICLE_v100105921mg, partial [Citrus clementina] Length = 402 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGKMGD +NAR LFE+MP+R+A+SWSAIMAAYSR++ + + L R Sbjct: 61 VDGYGKMGDFENARDLFEKMPERNAVSWSAIMAAYSRISDFKEVLSLFR 109 >ref|XP_007202004.1| hypothetical protein PRUPE_ppa021060mg, partial [Prunus persica] gi|462397535|gb|EMJ03203.1| hypothetical protein PRUPE_ppa021060mg, partial [Prunus persica] Length = 554 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 +DGYGK GDV+NAR LF+EMP+R+AISWSA+MAAYSRV+ + + L R Sbjct: 211 IDGYGKAGDVENARALFDEMPERNAISWSAMMAAYSRVSHFREVLSLFR 259 >ref|XP_008242855.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like, partial [Prunus mume] Length = 355 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 +DGYGK GDV+NAR LF+EMP+R+AISWSA+MAAYSRV + + L R Sbjct: 185 IDGYGKAGDVENARALFDEMPERNAISWSAMMAAYSRVNHFREVLSLFR 233 >ref|XP_002282063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 533 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRV 366 +DGYGKMGDV++AR LFE+MP+R+AISWSA+MAAYSRV Sbjct: 187 IDGYGKMGDVEHARILFEDMPERNAISWSAVMAAYSRV 224 >emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] Length = 805 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRV 366 +DGYGKMGDV++AR LFE+MP+R+AISWSA+MAAYSRV Sbjct: 459 IDGYGKMGDVEHARILFEDMPERNAISWSAVMAAYSRV 496 >ref|XP_014495112.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vigna radiata var. radiata] Length = 524 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/39 (74%), Positives = 38/39 (97%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGKMG+V+ AR++FE+MPDR+A+SWSA+MAAYSRV+ Sbjct: 181 VDGYGKMGNVEEAREVFEQMPDRNAVSWSAMMAAYSRVS 219 >ref|XP_010047826.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Eucalyptus grandis] Length = 534 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGK GD++NAR LF+EMP+R+ ISWSA+MAAYSRV+ + + L R Sbjct: 188 VDGYGKAGDLENARLLFDEMPERNVISWSAMMAAYSRVSDFKEVLSLFR 236 >ref|XP_013443472.1| PPR containing plant-like protein [Medicago truncatula] gi|657371507|gb|KEH17497.1| PPR containing plant-like protein [Medicago truncatula] Length = 533 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/47 (57%), Positives = 41/47 (87%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHL 339 +DGYGK+GDV++AR++F+EMP+R+ +SWSA+MAAYSRV+ + + L Sbjct: 188 IDGYGKIGDVESAREMFDEMPERNVVSWSAMMAAYSRVSEFREVLDL 234 >gb|KCW79820.1| hypothetical protein EUGRSUZ_C01164, partial [Eucalyptus grandis] Length = 490 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGK GD++NAR LF+EMP+R+ ISWSA+MAAYSRV+ + + L R Sbjct: 146 VDGYGKAGDLENARLLFDEMPERNVISWSAMMAAYSRVSDFKEVLSLFR 194 >ref|XP_007138308.1| hypothetical protein PHAVU_009G197700g [Phaseolus vulgaris] gi|561011395|gb|ESW10302.1| hypothetical protein PHAVU_009G197700g [Phaseolus vulgaris] Length = 523 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGKMG+V AR++FE+MPDR+A+SWSA++AAYSRV+ Sbjct: 181 VDGYGKMGNVDKAREVFEQMPDRNAVSWSAMIAAYSRVS 219 >ref|XP_004152427.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] gi|778700107|ref|XP_011654814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 470 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGK+GD+++AR LF+EMP+R+ ISWSA+MAAYSRV+ Sbjct: 184 VDGYGKVGDIESARVLFDEMPERNVISWSAMMAAYSRVS 222 >ref|XP_011093560.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] Length = 537 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVTAMHKNVHLQR 333 VDGYGKMGDV+ AR LF+EMP+R+ ISWS IMAAYSR + + + L R Sbjct: 184 VDGYGKMGDVEKARALFDEMPERNVISWSTIMAAYSRKSDFREVLCLYR 232 >ref|XP_008437069.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X2 [Cucumis melo] Length = 474 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGK+GD+++AR LF+EMP+R+ ISWSA+MAAYSRV+ Sbjct: 184 VDGYGKVGDIESARVLFDEMPERNVISWSAMMAAYSRVS 222 >ref|XP_008437067.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Cucumis melo] gi|659073454|ref|XP_008437068.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Cucumis melo] Length = 528 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGK+GD+++AR LF+EMP+R+ ISWSA+MAAYSRV+ Sbjct: 184 VDGYGKVGDIESARVLFDEMPERNVISWSAMMAAYSRVS 222 >gb|KGN50259.1| hypothetical protein Csa_5G162080 [Cucumis sativus] Length = 528 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGK+GD+++AR LF+EMP+R+ ISWSA+MAAYSRV+ Sbjct: 184 VDGYGKVGDIESARVLFDEMPERNVISWSAMMAAYSRVS 222 >gb|KHN08393.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 345 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/39 (69%), Positives = 39/39 (100%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGKMG+V++AR++F++MP+R+A+SWSA+MAAYSRV+ Sbjct: 2 VDGYGKMGNVKSAREVFDKMPERNAVSWSAMMAAYSRVS 40 >ref|XP_003525932.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] gi|947106590|gb|KRH54973.1| hypothetical protein GLYMA_06G222600 [Glycine max] gi|947106591|gb|KRH54974.1| hypothetical protein GLYMA_06G222600 [Glycine max] Length = 526 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/39 (69%), Positives = 39/39 (100%) Frame = -2 Query: 479 VDGYGKMGDVQNARQLFEEMPDRSAISWSAIMAAYSRVT 363 VDGYGKMG+V++AR++F++MP+R+A+SWSA+MAAYSRV+ Sbjct: 183 VDGYGKMGNVKSAREVFDKMPERNAVSWSAMMAAYSRVS 221