BLASTX nr result
ID: Ziziphus21_contig00035115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035115 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106138.1| hypothetical protein L484_003641 [Morus nota... 77 5e-12 >ref|XP_010106138.1| hypothetical protein L484_003641 [Morus notabilis] gi|587920494|gb|EXC07932.1| hypothetical protein L484_003641 [Morus notabilis] Length = 816 Score = 77.0 bits (188), Expect = 5e-12 Identities = 45/101 (44%), Positives = 59/101 (58%) Frame = -1 Query: 308 SINPQFASESRGQGSADAVLSRGNSLESCRNKGHNIQSNPTFASLYGAGELTDLEKHFNG 129 S N ASESR Q S D +L +GNSLESCRN H++ Y G LT+ E++ Sbjct: 259 SHNHNSASESRLQVSPDVILWKGNSLESCRNTEHDVME-------YSMGALTETERNLQA 311 Query: 128 NSGNLMDNQQPMSSIYAAGGEIPEKESSLHRFPKELAEEFK 6 +S NL NQ + S++A + E+ +SL RFP EL EEFK Sbjct: 312 SSRNLTGNQHSVPSVFATQSGVSEQANSLERFP-ELFEEFK 351