BLASTX nr result
ID: Ziziphus21_contig00035060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00035060 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB61973.1| hypothetical protein B456_009G3952002, partial [G... 57 4e-06 >gb|KJB61973.1| hypothetical protein B456_009G3952002, partial [Gossypium raimondii] Length = 225 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/56 (62%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 171 RSRRYRLPQDWLISHPDLKRAQKINRIEFSLSFVCIFIHVLP*KKRRLNKNE-WIG 7 R R+ LPQD LIS LKRAQKINRIEFSLSFV I IHVL K+ K W+G Sbjct: 163 RKRKKSLPQDELISQSILKRAQKINRIEFSLSFVWIPIHVLLNKQGIEQKTSGWLG 218