BLASTX nr result
ID: Ziziphus21_contig00034963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034963 (231 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69243.1| hypothetical protein VITISV_038879 [Vitis vinifera] 63 8e-08 >emb|CAN69243.1| hypothetical protein VITISV_038879 [Vitis vinifera] Length = 322 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/61 (50%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = -2 Query: 191 TEETIFDHIRKKAKNFPQ--LRKQPEYCTDAFDVLQGTKCSDVMGDYILISDTENGEVEK 18 +E+TIFDHIR+KAKNFP L+ QP D+FD L+GT S+ + I+ISD+E ++EK Sbjct: 157 SEDTIFDHIRRKAKNFPNTSLKNQPVLHEDSFDTLEGTNSSEALKTTIVISDSEPKKMEK 216 Query: 17 D 15 + Sbjct: 217 E 217