BLASTX nr result
ID: Ziziphus21_contig00034900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034900 (502 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008231467.1| PREDICTED: uncharacterized protein LOC103330... 60 8e-07 ref|XP_007220243.1| hypothetical protein PRUPE_ppa001793mg [Prun... 59 1e-06 >ref|XP_008231467.1| PREDICTED: uncharacterized protein LOC103330644 [Prunus mume] Length = 763 Score = 59.7 bits (143), Expect = 8e-07 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -3 Query: 257 MLVQNPPTTPKPHQKSSQTHLGDNFPRPKPITLPKWVSINLFKITTFSILTLTIAA 90 MLVQ+ +TPKP + +FP+ K T PKWVS NLFKITT S LTLTIAA Sbjct: 1 MLVQDR-STPKPSKPEQPFLTASHFPQSKIFTFPKWVSFNLFKITTISFLTLTIAA 55 >ref|XP_007220243.1| hypothetical protein PRUPE_ppa001793mg [Prunus persica] gi|462416705|gb|EMJ21442.1| hypothetical protein PRUPE_ppa001793mg [Prunus persica] Length = 763 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -3 Query: 257 MLVQNPPTTPKPHQKSSQTHLGDNFPRPKPITLPKWVSINLFKITTFSILTLTIAA 90 MLVQ+ +TPKP + +FP+ K T PKWVS NLFKITT S LTLTIAA Sbjct: 1 MLVQDR-STPKPSKPQQPLLTESHFPQSKIFTFPKWVSFNLFKITTISFLTLTIAA 55