BLASTX nr result
ID: Ziziphus21_contig00034878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00034878 (284 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442843.1| hypothetical protein MTR_0082s0290 [Medicago... 53 3e-14 >ref|XP_013442843.1| hypothetical protein MTR_0082s0290 [Medicago truncatula] gi|657370807|gb|KEH16868.1| hypothetical protein MTR_0082s0290 [Medicago truncatula] Length = 126 Score = 53.1 bits (126), Expect(3) = 3e-14 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 140 KGIGPVQAARLYSSIPAATHDPIGTISAPLSR 45 K IGPVQAARLYSSIPAATHDPIGTI L + Sbjct: 27 KRIGPVQAARLYSSIPAATHDPIGTICPYLDK 58 Score = 38.5 bits (88), Expect(3) = 3e-14 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 192 THQSARPLSYSALPPIK 142 THQSARPLSYSALPPIK Sbjct: 11 THQSARPLSYSALPPIK 27 Score = 33.1 bits (74), Expect(3) = 3e-14 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -2 Query: 49 LDKKRNAPSPTALSSA 2 LDKK+NAPSPTALSSA Sbjct: 56 LDKKQNAPSPTALSSA 71